Azospirillum thiophilum: AL072_07660 Help Entry AL072_07660       CDS       T04091                                  Name (GenBank) hypothetical protein   KO K03116   sec-independent protein translocase protein TatA Organism ati  Azospirillum thiophilum Pathway ati03060   Protein export ati03070   Bacterial secretion system Brite KEGG Orthology (KO) [BR:ati00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03060 Protein export     AL072_07660  09130 Environmental Information Processing   09131 Membrane transport    03070 Bacterial secretion system     AL072_07660  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:ati02044]     AL072_07660 Secretion system [BR:ati02044]  Twin-arginine translocation (Tat) system   Twin-arginine translocation (Tat) pathway protein    AL072_07660 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  TatA_B_E Alpha_GJ Motif Other DBs NCBI-ProteinID:  ALG70812 UniProt:  A0A0F2KXU6 LinkDB All DBs Position 1:complement(1658950..1659225) Genome browser AA seq 91 aa AA seqDB search MGSFSIWHWLIVLVIVLLLFGAGKLPNVMGDIAKGVKAFKSGLKDEEDEKTAATNATTQV PPAAINPAAQPTASTAPQPQPPADPAKPQQG NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgggcagtttcagcatctggcactggttgatcgttctggtcatcgtgcttctcctgttc ggcgccggcaagctgcccaacgtgatgggcgacatcgccaagggcgtgaaggccttcaag tccggcctgaaggacgaggaggacgagaagaccgcggccacgaacgccaccacccaggtg ccgcccgccgcgatcaatccggccgcccagccgaccgcgtccaccgcgccccagccccag ccgccggccgacccggccaagccgcagcagggctga

DBGET integrated database retrieval system