Azospirillum thiophilum: AL072_18330 Help Entry AL072_18330       CDS       T04091                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ati  Azospirillum thiophilum Pathway ati01100   Metabolic pathways ati01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ati00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AL072_18330    00074 Mycolic acid biosynthesis     AL072_18330   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AL072_18330 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF3051 Motif Other DBs NCBI-ProteinID:  ALG73207 UniProt:  A0AAC8ZV16 LinkDB All DBs Position 2:1075613..1075861 Genome browser AA seq 82 aa AA seqDB search MTREQVYEKLKGYLEDMFEVEPDRVTPESHLFEDLDLDSIDAVDLVVKLQDLTGRKFKPE EFKSVRTVGDILDRVQALLLAA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgacccgcgagcaagtctatgaaaagctgaagggctacctggaggacatgttcgaggtg gaaccggacagggttacacccgaatcgcacctgttcgaggatctcgatctggacagcatc gacgccgtcgatctcgtcgtgaagcttcaggacctgaccgggcgcaaattcaagcccgag gagttcaagagcgtgcgcaccgtcggcgacattctcgaccgcgtgcaggcgcttcttctt gcggcctag

DBGET integrated database retrieval system