Actinotignum timonense: CYJ17_0004275 Help Entry CYJ17_0004275     CDS       T09485                                  Name (GenBank) mycoredoxin   KO K18917   mycoredoxin [EC:1.20.4.3] Organism atim  Actinotignum timonense Brite KEGG Orthology (KO) [BR:atim00001]  09190 Not Included in Pathway or Brite   09191 Unclassified: metabolism    99980 Enzymes with EC numbers     CYJ17_0004275 Enzymes [BR:atim01000]  1. Oxidoreductases   1.20  Acting on phosphorus or arsenic in donors    1.20.4  With disulfide as acceptor     1.20.4.3  mycoredoxin      CYJ17_0004275 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Glutaredoxin Thioredoxin Glrx-like GST_N_2 Thioredoxin_2 ABC_transp_aux Motif Other DBs NCBI-ProteinID:  WOT00850 LinkDB All DBs Position complement(1029225..1029482) Genome browser AA seq 85 aa AA seqDB search MADLTMYTTSWCGYCRNLSAQLKRAGITWNEVNIEEDEAAAVKVAALNGGNKVVPTLEFA DGATLTNPSLKEVQAKLAELASPGS NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atggctgatctcacaatgtatacaacgtcgtggtgcggctactgccgtaacctttccgcc cagctcaagcgggccggcatcacctggaatgaggtgaatattgaggaggatgaagccgcg gccgtgaaggttgcggccctcaacggtggcaataaagtggtacccactcttgagtttgcc gacggcgccaccctgacgaatccgagcctgaaagaggtgcaggcaaaactcgccgaactc gcctcccccgggagctaa

DBGET integrated database retrieval system