Aureibacter tunicatorum: AUTU_22730 Help Entry AUTU_22730        CDS       T09744                                  Name (GenBank) hypothetical protein   KO K03602   exodeoxyribonuclease VII small subunit [EC:3.1.11.6] Organism atk  Aureibacter tunicatorum Pathway atk03430   Mismatch repair Brite KEGG Orthology (KO) [BR:atk00001]  09120 Genetic Information Processing   09124 Replication and repair    03430 Mismatch repair     AUTU_22730  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:atk03400]     AUTU_22730 Enzymes [BR:atk01000]  3. Hydrolases   3.1  Acting on ester bonds    3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters     3.1.11.6  exodeoxyribonuclease VII      AUTU_22730 DNA repair and recombination proteins [BR:atk03400]  Prokaryotic type   SSBR (single strand breaks repair)    MMR (mismatch excision repair)     DNA exonucleases      AUTU_22730 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Exonuc_VII_S Exo70_N Perilipin DUF6730 MtrG ARM_TT21_5th CdvA RPW8 MTR4_beta-barrel NfeD1b_N Motif Other DBs NCBI-ProteinID:  BDD04790 LinkDB All DBs Position 2672788..2672985 Genome browser AA seq 65 aa AA seqDB search MEIENLSYKEAMKKLESILEKVENPETDLDELLSLIEEAGKLMEYCKGKLQNTEEKINKS IEKLN NT seq 198 nt NT seq  +upstreamnt  +downstreamnt atggaaattgaaaatctatcgtataaagaagcgatgaaaaaattagaatcgattttggaa aaggtagaaaaccctgaaaccgatcttgatgaactgctgtctctaatagaggaagcggga aaactaatggagtattgcaaaggcaaacttcagaatactgaagaaaaaattaacaaatca atcgaaaaactaaactaa

DBGET integrated database retrieval system