Actinocatenispora thailandica: Athai_19920 Help Entry Athai_19920       CDS       T07045                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism atl  Actinocatenispora thailandica Pathway atl01100   Metabolic pathways atl01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:atl00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Athai_19920 (acpP)    00074 Mycolic acid biosynthesis     Athai_19920 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Athai_19920 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L50 Motif Other DBs NCBI-ProteinID:  BCJ34489 UniProt:  A0A7R7HWY3 LinkDB All DBs Position complement(2214545..2214787) Genome browser AA seq 80 aa AA seqDB search MTRDEIRTGLADILEEVAGVDKSDVADEKSFTEELDVDSLSMVEVVVAAEEKFGVKIPDD EVPNLKTVGDAVTYIEKNAA NT seq 243 nt NT seq  +upstreamnt  +downstreamnt atgacccgcgacgagattcgcaccggcctggccgacattctggaagaggtggccggcgtg gacaagtccgacgtcgccgacgagaagtcgttcaccgaggaactggacgtcgactcgctg tcgatggtggaggtcgtggtcgccgccgaggagaagttcggcgtgaagatccccgacgac gaggtcccgaacctcaagaccgtcggcgacgcggtcacctacatcgagaagaacgcggcc tga

DBGET integrated database retrieval system