KEGG   Anaerolinea thermophila: ANT_04670
Entry
ANT_04670         CDS       T01410                                 
Symbol
thrC
Name
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
atm  Anaerolinea thermophila
Pathway
atm00260  Glycine, serine and threonine metabolism
atm00750  Vitamin B6 metabolism
atm01100  Metabolic pathways
atm01110  Biosynthesis of secondary metabolites
atm01120  Microbial metabolism in diverse environments
atm01230  Biosynthesis of amino acids
Module
atm_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:atm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    ANT_04670 (thrC)
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    ANT_04670 (thrC)
Enzymes [BR:atm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     ANT_04670 (thrC)
SSDB
Motif
Pfam: PALP C1_2
Other DBs
NCBI-ProteinID: BAJ62501
UniProt: E8N0V6
LinkDB
Position
complement(500929..502188)
AA seq 419 aa
MTRATFQGYRCSLCGAEFAPQDWLYTCPHDGGNLDVVLDTPAIRQQTSPRQISAQTEPSL
WRYLPLLPVDDPGGQGTPLRTAGWTPLYSPPALKAQTSLHALWVKDEGKNPTASFKDRAS
AVVVARARQIGAEVVVTASTGNAGAALAGMAAAVGHRAVIFAPRTAPPAKIAQLLVFGAQ
VILVDGNYDNAFDLTVQAAQEFGWYCRNTGYNAFTAEGKKTAALEIFEQVILPNRLDRPL
CVFVSVGDGNIISGIHKGFKDLYALGWLETMPRLFGVQSTGSAAVANAFFAGTEEITPVQ
AATLADSISVDLPRDGVRAVRAARQTGGAYVLVSDDAILQAIAALGKAGIFAEPAGATAY
AGLLEALKSGQIQPDDPVVVINTGSGLKDVKSAMRAVTEAPVIEPNLNALKRLLEKNLR
NT seq 1260 nt   +upstreamnt  +downstreamnt
atgacgcgagcaacctttcaaggctatcgttgcagtctctgcggggcagaatttgccccg
caggattggctttacacctgccctcacgatgggggcaatctggatgtggtgctggatact
cccgcgattcggcagcaaacttccccccgccagatttccgcgcaaacggaaccgtctctc
tggcgctatttgccgcttttgccggtggatgacccgggcgggcagggaacccccctgcgc
acggcaggctggacgccgctctactcccccccggcgctgaaagcgcaaaccagtttgcat
gccctgtgggtcaaggatgaagggaaaaaccccacggcgtctttcaaagaccgcgccagc
gccgtggtggttgcccgcgcgcggcagattggcgccgaagtggtggtgacggcttctacc
ggcaacgcaggcgcggcgctggcaggcatggcggcggcagtgggtcaccgcgccgtcatc
tttgccccgcgtacagccccgcccgccaaaattgcccagctgctggtgttcggcgcgcag
gtcattctggtggatggcaattacgacaacgcctttgacctgaccgtacaagccgcgcag
gaatttggctggtactgtcgcaacaccggctataacgcttttaccgccgaaggaaagaaa
accgccgcgctggagatttttgaacaggtcatcctgcccaaccgtctggatcgccccctg
tgtgtcttcgtctcggtgggcgatggcaatatcatctccggcattcacaaaggctttaaa
gacctgtacgcgctgggctggctggagaccatgccgcgtctgtttggcgtgcaaagcacc
ggctcggcggcggttgccaatgccttctttgccggaacggaagagattactcccgtgcaa
gccgccacacttgccgacagcatctcggtggatttgccgcgcgatggcgtgcgggcggtg
cgcgcggcgcgtcaaaccggcggagcgtacgtactcgtctccgatgacgctatcctgcaa
gccatcgccgcgctgggcaaagccggcatctttgccgaaccggcgggcgcaacggcgtat
gctggtttgctcgaagccctgaagtccgggcaaatccagccggatgaccccgtggtggtc
atcaacaccggctccggcttgaaggatgtgaaatctgccatgcgggcggtgacggaagca
cctgtcattgaaccgaatttgaacgctcttaagcgtttgctggagaaaaatctgcgttaa

DBGET integrated database retrieval system