KEGG   Acetobacter tropicalis: CIW82_10125
Entry
CIW82_10125       CDS       T05181                                 
Name
(GenBank) AraC family transcriptional regulator
Organism
ato  Acetobacter tropicalis
SSDB
Motif
Pfam: Cupin_6 HTH_18 HTH_AraC Cupin_2 AraC_binding
Other DBs
NCBI-ProteinID: ATJ90990
UniProt: A0A252A160
LinkDB
Position
2174050..2175006
AA seq 318 aa
MHDISSSNSPVGGSDPLTRMLQSLRLDGLEYGRRHLSGTWAYSFHEKDNAYFHFIGGAPC
WLLVQDREWSELQTGDAILLPRGDAHVLASAPDAVRPPFPPWKCRPIWEDGYDPEAAREN
REGLLFYGSMRFNLDRSHPLFRCMSPVLHARALIGSESLILPLLNALAAEMVSRRVGAAG
MAARLADVLAVQIIRSWMESGTLDDGAWINAARQPQIGQVLAAIHEDPGGDWSVGKLAAI
AGMSRSAFATAFASILGDTPARYLTDVRMQQAKQWIMRDNARIAEVAERLRYDSEASFSR
AFKRVIGMPPSSYRVGKR
NT seq 957 nt   +upstreamnt  +downstreamnt
atgcatgacatttcgtccagcaattcgccggttggcggctctgatccgcttacgcgcatg
ctccaatccttacggctcgatggcctcgaatacggacggcggcacctgtcaggcacttgg
gcctatagcttccatgagaaggacaatgcctatttccacttcatagggggcgcgccgtgc
tggctgctcgtgcaggaccgcgaatggtcggagctccagacgggggacgctattctgctg
ccgcgcggtgatgcacatgtattggccagcgcgcctgatgctgtcaggccaccctttccg
ccttggaaatgccgtccgatctgggaagatggctacgatccagaggccgccagagagaac
cgggaggggctgctgttttacgggtcgatgcgcttcaatctcgatcgttcgcatcccttg
tttcgctgcatgtcccctgtgctgcatgcccgtgcactgatcggatctgagtctctgatc
ctgccactgctcaatgcccttgccgcggagatggtaagccgcagggtcggtgcggctggg
atggctgcccgactggccgacgtgcttgccgtgcagatcatccgctcctggatggaaagt
gggactttggatgacggagcctggatcaacgcagcacggcagcctcaaatcggtcaggtc
cttgccgcgatccatgaggatcccggcggggactggtcggtaggcaaacttgccgcgatt
gcgggcatgtcacgctcggcctttgcgactgcattcgccagcatcctcggcgatacgcct
gcccgctatctgacagacgtccgaatgcagcaggccaagcagtggatcatgcgggacaat
gctcgcatcgcagaggttgcagagcgattgcgatatgattcagaagcctcgttcagccgg
gcgttcaaaagagtgataggaatgccgcccagcagttaccgggtcggcaaacggtag

DBGET integrated database retrieval system