Acetobacter tropicalis: CIW82_15835 Help Entry CIW82_15835       CDS       T05181                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism ato  Acetobacter tropicalis Pathway ato01100   Metabolic pathways ato01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:ato00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     CIW82_15835    00074 Mycolic acid biosynthesis     CIW82_15835   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     CIW82_15835 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 RE_HaeII Motif Other DBs NCBI-ProteinID:  ATJ91920 UniProt:  A0A094YLS8 LinkDB All DBs Position 3452102..3452353 Genome browser AA seq 83 aa AA seqDB search MSETVESVSALIIQKLLANPKVPRDIDGNCKIMEDLAFDSLAVMNFVMEVEDTLDVSVPL DKLADIRTINDLATCIVDLKNKG NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atgagcgaaaccgttgaaagcgtttctgcgctgatcatccagaagcttctcgccaacccg aaggtgcctcgcgatatcgatggaaactgcaagatcatggaagatcttgcctttgattct ctggcggtcatgaactttgtcatggaagttgaagatacgctggatgtctccgttccgttg gacaagctggctgacatccgtaccatcaatgatcttgcaacctgcattgttgacctgaaa aacaaaggctga

DBGET integrated database retrieval system