Acetobacter tropicalis: CIW82_18565 Help Entry CIW82_18565       CDS       T05181                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism ato  Acetobacter tropicalis Brite KEGG Orthology (KO) [BR:ato00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ato03032]     CIW82_18565    03036 Chromosome and associated proteins [BR:ato03036]     CIW82_18565    03400 DNA repair and recombination proteins [BR:ato03400]     CIW82_18565 DNA replication proteins [BR:ato03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     CIW82_18565 Chromosome and associated proteins [BR:ato03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     CIW82_18565 DNA repair and recombination proteins [BR:ato03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       CIW82_18565 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 DUF6470 Motif Other DBs NCBI-ProteinID:  ATJ92852 UniProt:  A0A291PN47 LinkDB All DBs Position pAtBDGP1A:76761..77024 Genome browser AA seq 87 aa AA seqDB search MIERIVAATDISKKDAKAALETVFAAITEAAAKGDETTISGFGKFVVRQMAERKGRNPQT GADLVIPASRKLAYTPAKAVKDALTGQ NT seq 264 nt NT seq  +upstreamnt  +downstreamnt ttgattgaacgtattgttgctgcaacggatatttcaaaaaaagatgccaaagcagccttg gaaacagtatttgcagcaattactgaagccgctgcgaaaggtgacgaaacgaccatctca ggatttggcaaatttgttgtccgtcagatggctgagcgcaaaggacgcaatccacaaact ggtgcggatctggtgatccccgcatctcgtaaactggcctatacaccagcaaaggctgtc aaggatgctctgacaggtcaatga

DBGET integrated database retrieval system