Aliarcobacter trophiarum: ATR_1741 Help Entry ATR_1741          CDS       T06356                                  Symbol acpP3 Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism atp  Aliarcobacter trophiarum Pathway atp01100   Metabolic pathways atp01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:atp00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     ATR_1741 (acpP3)    00074 Mycolic acid biosynthesis     ATR_1741 (acpP3)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     ATR_1741 (acpP3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N TerB Motif Other DBs NCBI-ProteinID:  AXK49564 UniProt:  A0AAD0VMT4 LinkDB All DBs Position 1678965..1679195 Genome browser AA seq 76 aa AA seqDB search MALLDDVKAVVVDQLDCDPAEVKEGSKFIEDLGADSLDVVELVMALEEKFDIEIPDEEAE KILTVGDAIAYIENNK NT seq 231 nt NT seq  +upstreamnt  +downstreamnt atggcattattagatgatgtaaaagctgttgtagttgatcaattagattgcgatccagct gaagttaaagaaggttcgaaattcatcgaagatttaggagcagattctctagatgtagta gagcttgtaatggctttagaggaaaagtttgatatcgaaatccctgatgaagaagctgaa aaaatcttaactgttggtgatgcaatagcatacattgaaaacaataaatag

DBGET integrated database retrieval system