Amborella trichopoda: 110008074 Help Entry 110008074         CDS       T02990                                  Name (RefSeq) calmodulin-like   KO K02183   calmodulin Organism atr  Amborella trichopoda Pathway atr04016   MAPK signaling pathway - plant atr04070   Phosphatidylinositol signaling system atr04075   Plant hormone signal transduction Brite KEGG Orthology (KO) [BR:atr00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     110008074    04070 Phosphatidylinositol signaling system     110008074    04075 Plant hormone signal transduction     110008074  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:atr01009]     110008074   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:atr04131]     110008074    03036 Chromosome and associated proteins [BR:atr03036]     110008074   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:atr04147]     110008074 Protein phosphatases and associated proteins [BR:atr01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      110008074 Membrane trafficking [BR:atr04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     110008074 Chromosome and associated proteins [BR:atr03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      110008074 Exosome [BR:atr04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    110008074 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_6 EF-hand_1 EF-hand_5 Caleosin Toprim_2 EF-hand_9 Motif Other DBs NCBI-GeneID:  110008074 NCBI-ProteinID:  XP_020528911 LinkDB All DBs Position Unknown AA seq 142 aa AA seqDB search MVDQFSSYDVSIFREAICYYDRDGDGKLNLNEVSKAVQSLGCNFSIEDFPEGKEPLDLEA FLGVVREKSIAKRSEELGRAFRLFDRNQSGMIYVGELRHLLTSIGEKLTGAEFDSWIDQE KECDSSGCASFEFLINKLTRHG NT seq 429 nt NT seq  +upstreamnt  +downstreamnt atggtggatcagttttccagctacgacgtctccattttccgagaagccatctgctattac gatcgagatggcgatggaaaactcaacctgaatgaagttagcaaggctgttcaatctcta ggatgcaatttctctattgaagactttcctgagggaaaagaacccttagatttggaggca tttttaggggtggtgagagagaaatccatagctaagagatcagaagaactaggtcgagct ttccgactgttcgataggaaccaaagtggaatgatttatgtcggggagcttcgacatttg ctgacaagcatcggtgagaagttgacaggagcagagttcgattcatggatcgatcaggag aaggagtgtgattcttcagggtgtgctagttttgagtttcttatcaataagcttacgcgt cacggttag

DBGET integrated database retrieval system