Amborella trichopoda: 18426610 Help Entry 18426610          CDS       T02990                                  Name (RefSeq) probable dynein light chain   KO K10418   dynein light chain LC8-type Organism atr  Amborella trichopoda Pathway atr04145   Phagocytosis atr04517   IgSF CAM signaling atr04814   Motor proteins Brite KEGG Orthology (KO) [BR:atr00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     18426610  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     18426610   09142 Cell motility    04814 Motor proteins     18426610  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:atr03037]     18426610    04812 Cytoskeleton proteins [BR:atr04812]     18426610 Cilium and associated proteins [BR:atr03037]  Motile cilia and associated proteins   Dynein arm    18426610 Cytoskeleton proteins [BR:atr04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      18426610 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  18426610 NCBI-ProteinID:  XP_006833316 UniProt:  W1NV92 LinkDB All DBs Position Unknown AA seq 93 aa AA seqDB search MLEGKALVQDTDMPVKMQIHAMNTASRALDLYDVSDCKSMAAYIKKEFDKVYGSGWQCVV GSNFGCFFTHSQGTFIYFALETLNFLIFKAASA NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgttggaaggcaaggccctagtccaagacacggacatgcctgtgaagatgcagatacac gccatgaacactgcttctcgagctctggatctttacgatgtctcagactgcaaaagcatg gcagcctatattaaaaaggaatttgacaaggtttatggctcaggatggcaatgtgttgtg ggatcaaatttcggttgctttttcacacattctcagggcacttttatttattttgctcta gagactcttaatttcttgatatttaaagcagcctctgcatag

DBGET integrated database retrieval system