Amborella trichopoda: 18427603 Help Entry 18427603          CDS       T02990                                  Name (RefSeq) rac-like GTP-binding protein 3   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism atr  Amborella trichopoda Pathway atr04145   Phagosome atr04148   Efferocytosis atr04620   Toll-like receptor signaling pathway atr05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:atr00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     18427603    04148 Efferocytosis     18427603  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     18427603  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     18427603  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:atr04131]     18427603   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:atr04147]     18427603    04031 GTP-binding proteins [BR:atr04031]     18427603 Membrane trafficking [BR:atr04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     18427603  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     18427603   Macropinocytosis    Ras GTPases     18427603  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     18427603 Exosome [BR:atr04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    18427603   Exosomal proteins of other body fluids (saliva and urine)    18427603   Exosomal proteins of colorectal cancer cells    18427603   Exosomal proteins of bladder cancer cells    18427603 GTP-binding proteins [BR:atr04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     18427603 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU B12-binding Sua5_C ParE-like_toxin Motif Other DBs NCBI-GeneID:  18427603 NCBI-ProteinID:  XP_011620907 LinkDB All DBs Position Unknown AA seq 213 aa AA seqDB search MASSASRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVDGTTVNLGL WDTAGQEDYNRLRPLSYRGADVFVVAFSLVSRASYENVMKKWIPELQHYAPGVPVVLVGT KLDLREDKYYLSDHPGMVPVTTAQGEELRKQIGVAYYIECSSKTQQNVKSVFDAAIKVVI QPPKQKEKKKKPRRGCSLLNIFCGRNLMHTDSG NT seq 642 nt NT seq  +upstreamnt  +downstreamnt atggcttcgagtgcttcgaggttcataaagtgcgtcactgttggggatggagcagttggg aagacctgtatgctcatctgctacaccagtaacaagttcccaactgactatatacccacg gtgtttgataactttagcgctaatgtggttgtggatggaaccactgtgaacctgggcctc tgggatacagctgggcaagaagattacaataggctgaggcctttgagctacagaggagca gatgtgtttgtggtggctttctctttagtcagccgagctagttatgagaatgttatgaag aagtggattcctgaacttcaacattatgcacctggtgtccctgttgttcttgttggcacc aaattggatcttcgagaagataaatactatttgtctgatcatccaggcatggtaccggtg accacggcccaaggtgaggaattaaggaaacagattggtgtagcatattatatagaatgc agctcaaaaacccaacagaatgttaagtcagtttttgatgctgcaatcaaagtcgtcatt cagccacctaagcaaaaggaaaaaaagaaaaagcctcgacgtggatgttcattattgaat attttttgtgggaggaacctcatgcacactgactcaggttga

DBGET integrated database retrieval system