Amborella trichopoda: 18443841 Help Entry 18443841          CDS       T02990                                  Name (RefSeq) calmodulin   KO K02183   calmodulin Organism atr  Amborella trichopoda Pathway atr04016   MAPK signaling pathway - plant atr04070   Phosphatidylinositol signaling system atr04075   Plant hormone signal transduction Brite KEGG Orthology (KO) [BR:atr00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     18443841    04070 Phosphatidylinositol signaling system     18443841    04075 Plant hormone signal transduction     18443841  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:atr01009]     18443841   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:atr04131]     18443841    03036 Chromosome and associated proteins [BR:atr03036]     18443841   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:atr04147]     18443841 Protein phosphatases and associated proteins [BR:atr01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      18443841 Membrane trafficking [BR:atr04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     18443841 Chromosome and associated proteins [BR:atr03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      18443841 Exosome [BR:atr04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    18443841 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH SPARC_Ca_bdg EF_EFCAB10_C Dockerin_1 UPF0154 DUF5580_M EF-hand_11 Caleosin RNA_pol_Rpb4 EFhand_Ca_insen FCaBP_EF-hand SPEF2_C MotA_activ PA_Ig-like Fe_hyd_lg_C DUF1103 SurA_N_3 PhageMin_Tail MecA_N DUF6279 Motif Other DBs NCBI-GeneID:  18443841 NCBI-ProteinID:  XP_020529005 LinkDB All DBs Position Unknown AA seq 149 aa AA seqDB search MAEQLTEEQISEFKEAFSLFDKDGDGCITTKELGTVMRSLGQNPTEAELQDMINEVDADG NGTIDFPEFLNLMARKMKDTDSEEELKEAFKVFDKDQNGFISAAELRHVMTNLGEKLTDE EVEEMIREADVDGDGQVNYEEFVRMMLAK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggcggagcagctcacagaggagcagatctcggagttcaaggaagccttcagtcttttt gacaaagatggagacggctgcatcaccaccaaagagctgggaaccgtgatgagatcactt ggtcaaaacccaacagaagctgagctgcaagatatgatcaatgaagttgatgcagatggc aatgggaccatcgatttccctgagttcttgaatttgatggcacgtaaaatgaaggatacg gattctgaagaggaattgaaggaggctttcaaagtttttgataaggatcagaatggattc atttctgctgcagaactacggcatgtgatgaccaacttgggtgagaaattaactgacgaa gaagttgaggagatgattcgtgaggctgatgtggatggtgatggacaggtgaattacgag gaatttgttagaatgatgcttgcgaaatag

DBGET integrated database retrieval system