Amborella trichopoda: 2546575 Help Entry 2546575           CDS       T02990                                  Symbol psbF, AmtrCp038 Name (RefSeq) photosystem II protein VI   KO K02708   photosystem II cytochrome b559 subunit beta Organism atr  Amborella trichopoda Pathway atr00195   Photosynthesis atr01100   Metabolic pathways Module atr_M00161   Photosystem II atr_M00611   Oxygenic photosynthesis in plants and cyanobacteria Brite KEGG Orthology (KO) [BR:atr00001]  09100 Metabolism   09102 Energy metabolism    00195 Photosynthesis     2546575 (psbF)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:atr00194]     2546575 (psbF) Photosynthesis proteins [BR:atr00194]  Photosystem and electron transport system   Photosystem II (P680 chlorophyll a) [OT]    Main subunits     2546575 (psbF) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Cytochrom_B559 Motif Other DBs NCBI-GeneID:  2546575 NCBI-ProteinID:  NP_904115 UniProt:  P60248 LinkDB All DBs Position CP AA seq 39 aa AA seqDB search MTIDRTYPIFTVRWLAVHGLAVPTVFFLGSISAMQFIQR NT seq 120 nt NT seq  +upstreamnt  +downstreamnt atgaccatagatagaacctatccgatttttacagtgagatggttggctgttcacggacta gctgtacctacagtttttttcttggggtcaatatcagcaatgcagttcatccaacgataa

DBGET integrated database retrieval system