Amyelois transitella (navel orangeworm): 106130514
Help
Entry
106130514 CDS
T09957
Name
(RefSeq) cytochrome b-c1 complex subunit Rieske, mitochondrial-like
KO
K00411
ubiquinol-cytochrome c reductase iron-sulfur subunit [EC:
7.1.1.8
]
Organism
atra
Amyelois transitella (navel orangeworm)
Pathway
atra00190
Oxidative phosphorylation
atra01100
Metabolic pathways
atra04148
Efferocytosis
Module
atra_M00151
Cytochrome bc1 complex respiratory unit
Brite
KEGG Orthology (KO) [BR:
atra00001
]
09100 Metabolism
09102 Energy metabolism
00190 Oxidative phosphorylation
106130514
09140 Cellular Processes
09141 Transport and catabolism
04148 Efferocytosis
106130514
Enzymes [BR:
atra01000
]
7. Translocases
7.1 Catalysing the translocation of protons
7.1.1 Linked to oxidoreductase reactions
7.1.1.8 quinol---cytochrome-c reductase
106130514
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
UCR_TM
Rieske
Motif
Other DBs
NCBI-GeneID:
106130514
NCBI-ProteinID:
XP_013184817
LinkDB
All DBs
Position
Z:43166..43984
Genome browser
AA seq
272 aa
AA seq
DB search
MNVLNSSLVTRYGRGALTCCKERAMGVVDVEVSRRRRPCRTRANKGPQAKCPGTSWASFG
LATWTQVRFQKDCPRLHRDLNFPNFDDYRKDDYVDVRRTSWGSGDGKPGYSYVVSFFGLL
GATYATKTVLTHFVSYMSAAADVLALASIEVDLSKVQPGGTASFKWRGKPLFVKNRTQAE
IDSEADTPMSALRDPQTPDQRAQKPEWLIVIGICTHLGCVPIPNSGDWPGGFYCPCHGSH
YDNIGRARKGPAPLNLEVPPYKFMSDTLVLVG
NT seq
819 nt
NT seq
+upstream
nt +downstream
nt
atgaatgttttaaacagcagcttggtaacgcgctacggccgaggcgcactgacgtgttgc
aaggagagagcgatgggtgtggtggacgtggaggtgagtcgcagacgcagaccttgcagg
actcgagcaaataaaggcccgcaagcgaagtgtcccgggacctcgtgggcgagttttggg
ctggcgacgtggactcaggttcggttccaaaaagactgcccgcggctgcaccgcgatctg
aactttcctaacttcgatgactacaggaaggacgattacgtcgacgtgaggagaacgagt
tggggctcgggcgacggcaagcccgggtactcttacgtggtcagcttcttcgggctattg
ggcgcgacatatgctaccaagacggtgttaactcacttcgtgtcctatatgtcggcggcg
gcagatgtactggcattggcctccattgaggtggacctgtccaaggtgcagccgggcggc
accgcctccttcaagtggagaggcaagcccctgttcgtgaagaaccgaacgcaagccgaa
atagattcggaagccgacactccgatgtcggcgctgcgagacccgcagacgccggatcag
cgtgcgcagaagcccgagtggctgatcgtgatcggcatctgcacacacctgggctgcgtg
cccatccccaactccggggactggccgggcggcttctactgcccgtgccacggcagccac
tacgacaacatcgggagggcgcgcaaggggccggcgccgctcaatttggaagttccacct
tataaatttatgagtgatactctagttttagtagggtag
DBGET
integrated database retrieval system