Amaranthus tricolor (tampala): 130797515 Help Entry 130797515         CDS       T09367                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism atri  Amaranthus tricolor (tampala) Pathway atri04145   Phagosome atri04148   Efferocytosis atri04620   Toll-like receptor signaling pathway atri05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:atri00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     130797515    04148 Efferocytosis     130797515  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     130797515  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     130797515  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:atri04131]     130797515   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:atri04147]     130797515    04031 GTP-binding proteins [BR:atri04031]     130797515 Membrane trafficking [BR:atri04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     130797515  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     130797515   Macropinocytosis    Ras GTPases     130797515  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     130797515 Exosome [BR:atri04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    130797515   Exosomal proteins of other body fluids (saliva and urine)    130797515   Exosomal proteins of colorectal cancer cells    130797515   Exosomal proteins of bladder cancer cells    130797515 GTP-binding proteins [BR:atri04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     130797515 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU AAA_7 Motif Other DBs NCBI-GeneID:  130797515 NCBI-ProteinID:  XP_057516103 LinkDB All DBs Position 13:complement(18592413..18595919) Genome browser AA seq 196 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVMVDGNTVNLGLWD TAGQEDYNRLRPLSYRGADVFILAFSLISKASYENVAKKWIPELRHYAPGVPIILVGTKL DLRDDKQFFIDHPGAVPISTQQGEELKRVIGAPYYIECSSKTQQNVKAVFDAAIKVVLQP PKTKKKKKKAKGCYIL NT seq 591 nt NT seq  +upstreamnt  +downstreamnt atgagtgcatctaggttcatcaaatgcgtgacagttggtgatggtgctgtgggtaaaact tgtatgcttatttcctacaccagtaacacttttcctacagactatgtgcctacagttttc gataacttcagtgctaatgtcatggttgatgggaacaccgtcaacctaggcttgtgggat accgcaggtcaagaagactataatagattgagacctttaagctaccgtggagcagatgtg tttatcttagccttttcattgattagcaaggctagttatgaaaatgttgctaaaaagtgg attccggagttgaggcactatgcacctggtgttccaataattctcgttggtacaaaatta gatcttcgggatgacaagcaatttttcattgatcatcctggtgcagttcctatctcgact caacaaggagaggagctgaagagagtcattggcgctccatactacatagagtgcagttca aaaactcaacagaatgtgaaggcagttttcgatgcagccattaaggtcgtcctccagccg ccaaagacgaaaaaaaagaaaaagaaggcaaaagggtgttatattttgtga

DBGET integrated database retrieval system