Amaranthus tricolor (tampala): 130798670 Help Entry 130798670         CDS       T09367                                  Name (RefSeq) rac-like GTP-binding protein 3   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism atri  Amaranthus tricolor (tampala) Pathway atri04145   Phagosome atri04148   Efferocytosis atri04517   IgSF CAM signaling atri04518   Integrin signaling atri04620   Toll-like receptor signaling pathway atri05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:atri00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     130798670    04518 Integrin signaling     130798670  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     130798670    04148 Efferocytosis     130798670  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     130798670  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     130798670  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:atri04131]     130798670   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:atri04147]     130798670    04031 GTP-binding proteins [BR:atri04031]     130798670 Membrane trafficking [BR:atri04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     130798670  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     130798670   Macropinocytosis    Ras GTPases     130798670  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     130798670 Exosome [BR:atri04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    130798670   Exosomal proteins of other body fluids (saliva and urine)    130798670   Exosomal proteins of colorectal cancer cells    130798670   Exosomal proteins of bladder cancer cells    130798670 GTP-binding proteins [BR:atri04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     130798670 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  130798670 NCBI-ProteinID:  XP_057517743 LinkDB All DBs Position 13:complement(7702572..7706351) Genome browser AA seq 211 aa AA seqDB search MASSASRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVVEGTTVNLGL WDTAGQEDYNRLRPLSYRGGDVFVLAFSLVSRASYENVQKKWVPELQHFAAGIPIVLVGT KLDLREDKHYLADHPGIVPVSTSEGEELRKQIGALYYVECSSKTQQNVKAVFDAAIKVVI KPPQKQKEKKKKPRKGCIMNLFGGRSFWCLK NT seq 636 nt NT seq  +upstreamnt  +downstreamnt atggcttcaagtgcgtcaaggtttatcaaatgtgtaactgttggggatggagctgttggc aagacttgtatgctgatttgttatacaagtaacaaattccccactgattatatacctaca gtatttgacaatttcagtgctaatgtggttgttgaaggtaccactgtgaacttaggcctt tgggatactgctggacaagaggattacaacagattacggccattgagctaccgagggggc gatgtctttgtcttggctttttcattggtcagtcgtgcaagctatgagaatgtgcaaaag aagtgggtcccagaacttcagcattttgctgctggaataccaattgtgttggttggcacc aaattggatcttcgagaggacaaacactacttggcagatcatcctggaatagtgccagtt agcacatcagagggagaagaacttcgaaaacagattggtgctttatattacgtcgaatgc agttccaagactcaacagaatgtgaaagctgtttttgatgctgcaatcaaggtagttatc aagccgcctcagaaacaaaaagagaagaaaaagaagcccaggaagggatgtataatgaat ctctttggcggaaggagtttctggtgtctcaaatga

DBGET integrated database retrieval system