Amaranthus tricolor (tampala): 130798813 Help Entry 130798813         CDS       T09367                                  Name (RefSeq) rac-like GTP-binding protein 5   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism atri  Amaranthus tricolor (tampala) Pathway atri04145   Phagosome atri04148   Efferocytosis atri04620   Toll-like receptor signaling pathway atri05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:atri00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     130798813    04148 Efferocytosis     130798813  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     130798813  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     130798813  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:atri04131]     130798813   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:atri04147]     130798813    04031 GTP-binding proteins [BR:atri04031]     130798813 Membrane trafficking [BR:atri04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     130798813  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     130798813   Macropinocytosis    Ras GTPases     130798813  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     130798813 Exosome [BR:atri04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    130798813   Exosomal proteins of other body fluids (saliva and urine)    130798813   Exosomal proteins of colorectal cancer cells    130798813   Exosomal proteins of bladder cancer cells    130798813 GTP-binding proteins [BR:atri04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     130798813 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf AAA_7 Motif Other DBs NCBI-GeneID:  130798813 NCBI-ProteinID:  XP_057517891 LinkDB All DBs Position 1:complement(2590365..2595987) Genome browser AA seq 198 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGSTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELRHYAPGVPIILVGTKL DLRDDKQFFLDHPGAVPITTTQGEELKRQIGAAAYIECSAKTQQNIKSVFDAAIKVVLQP PKQKKRKKRKSQKGCSIL NT seq 597 nt NT seq  +upstreamnt  +downstreamnt atgagtgcttctaggttcataaaatgtgttactgttggtgatggagctgttggaaaaact tgtatgcttatttcttacaccagcaacactttccctactgattatgtgccaacagtgttt gacaatttcagtgctaatgtggtggtggatgggagcacagttaatcttgggttgtgggat actgctggccaggaagattacaatagattgagaccattgagctatcgaggcgccgatgta tttcttcttgccttttctcttatcagcaaagcaagctatgaaaatgtttcgaagaagtgg attcctgaattgaggcattatgctcctggtgtgcctatcattctcgttggaacaaaacta gatcttcgagatgataagcaatttttcctagaccatcctggtgcagtgcctatcacgaca acccagggagaggaactgaaaaggcagatcggagccgctgcttacatagagtgtagtgca aaaacacagcagaatatcaagtccgtgtttgatgctgcgattaaagtagtccttcaacca cctaagcagaagaagagaaagaagagaaagtcgcagaaaggttgttcaatattgtaa

DBGET integrated database retrieval system