Amaranthus tricolor (tampala): 130799991 Help Entry 130799991         CDS       T09367                                  Name (RefSeq) calmodulin-2/4   KO K02183   calmodulin Organism atri  Amaranthus tricolor (tampala) Pathway atri04016   MAPK signaling pathway - plant atri04070   Phosphatidylinositol signaling system atri04075   Plant hormone signal transduction atri04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:atri00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     130799991    04070 Phosphatidylinositol signaling system     130799991    04075 Plant hormone signal transduction     130799991  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     130799991  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:atri01009]     130799991   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:atri04131]     130799991    03036 Chromosome and associated proteins [BR:atri03036]     130799991   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:atri04147]     130799991 Protein phosphatases and associated proteins [BR:atri01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      130799991 Membrane trafficking [BR:atri04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     130799991 Chromosome and associated proteins [BR:atri03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      130799991 Exosome [BR:atri04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    130799991 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_8 EF-hand_6 EF-hand_5 EF-hand_9 AIF-1 EH EF_EFCAB10_C EF-hand_11 UPF0154 SPARC_Ca_bdg DUF5580_M EFhand_Ca_insen RNA_pol_Rpb4 Dockerin_1 MotA_activ SurA_N_3 SPEF2_C PA_Ig-like FCaBP_EF-hand MecA_N Motif Other DBs NCBI-GeneID:  130799991 NCBI-ProteinID:  XP_057519297 LinkDB All DBs Position 1:44351712..44353016 Genome browser AA seq 135 aa AA seqDB search MFHCMLSQMKKGCITTKELGTVMRSLGQNPTEAELQDMINEVDADGNGTIDFPEFLNLMA RKMKDTDSEEELKEAFRVFDKDQNGFISAAELRHVMTNLGEKLTDEEVDEMIREADVDGD GQINYEEFVKVMMAK NT seq 408 nt NT seq  +upstreamnt  +downstreamnt atgtttcattgcatgctatcccaaatgaaaaaaggttgtatcaccaccaaggagctcgga acagtgatgaggtcccttggtcagaacccaactgaggcagagcttcaagacatgataaat gaggttgatgctgatggaaacggtaccatcgacttcccagaattcctcaacctgatggcc agaaagatgaaagacactgattccgaggaagaacttaaagaagctttccgtgtcttcgac aaggatcaaaacggtttcatctctgctgctgagctgcgccatgtgatgacaaacctaggt gaaaagctcaccgatgaggaagtcgacgagatgatccgggaagctgatgttgatggtgat ggccaaatcaactacgaggagttcgtcaaagtgatgatggccaagtga

DBGET integrated database retrieval system