Amaranthus tricolor (tampala): 130813748 Help Entry 130813748         CDS       T09367                                  Name (RefSeq) ubiquitin-like protein ATG12   KO K08336   ubiquitin-like protein ATG12 Organism atri  Amaranthus tricolor (tampala) Pathway atri04136   Autophagy - other Brite KEGG Orthology (KO) [BR:atri00001]  09140 Cellular Processes   09141 Transport and catabolism    04136 Autophagy - other     130813748  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:atri04131]     130813748    04121 Ubiquitin system [BR:atri04121]     130813748    03029 Mitochondrial biogenesis [BR:atri03029]     130813748 Membrane trafficking [BR:atri04131]  Autophagy   Autophagosome formation proteins    Atg12 conjugation proteins     130813748 Ubiquitin system [BR:atri04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitin-like proteins (UBLs)    130813748 Mitochondrial biogenesis [BR:atri03029]  Mitochondrial quality control factors   Mitophagy factors    Autophagy-related proteins     130813748 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  APG12 Motif Other DBs NCBI-GeneID:  130813748 NCBI-ProteinID:  XP_057535592 LinkDB All DBs Position 5:22145464..22154047 Genome browser AA seq 94 aa AA seqDB search MASESPSAVRKVVIHLRATGDAPILKQQKFKVSGTDRFASVIDFLCRQLHRDTLFVYINS AFSPNPDESVIDLYNNFGIDGKLVVNYACSMAWG NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggcttccgagtcgcccagcgccgttcgaaaagttgtgattcatttgagggctacaggt gatgcacccattctcaagcaacaaaagttcaaggtttctggcactgacagatttgctagt gttattgattttttatgtcgtcaacttcatagagatactttgtttgtttacatcaacagt gccttttctccaaatcctgatgaatccgtgatagatctttacaacaattttggaattgat ggtaagctggttgtcaattatgcttgttccatggcgtggggctga

DBGET integrated database retrieval system