Amaranthus tricolor (tampala): 130816334
Help
Entry
130816334 CDS
T09367
Name
(RefSeq) SKP1-like protein 12
KO
K03094
S-phase kinase-associated protein 1
Organism
atri
Amaranthus tricolor (tampala)
Pathway
atri03083
Polycomb repressive complex
atri04120
Ubiquitin mediated proteolysis
atri04141
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:
atri00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
130816334
04120 Ubiquitin mediated proteolysis
130816334
09126 Chromosome
03083 Polycomb repressive complex
130816334
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
atri04131
]
130816334
04121 Ubiquitin system [BR:
atri04121
]
130816334
03036 Chromosome and associated proteins [BR:
atri03036
]
130816334
Membrane trafficking [BR:
atri04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
130816334
Ubiquitin system [BR:
atri04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
130816334
Cul7 complex
130816334
Chromosome and associated proteins [BR:
atri03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
130816334
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
130816334
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Skp1
Skp1_POZ
DUF5763
Motif
Other DBs
NCBI-GeneID:
130816334
NCBI-ProteinID:
XP_057538828
LinkDB
All DBs
Position
1:37502198..37502980
Genome browser
AA seq
158 aa
AA seq
DB search
MASSSSEKIITLMSSDGQTFDVESDIVESQSLMIKSLIKGHNFTNGVTPLKVHADILPHI
LDYCKKHAKQDPPINDEELKKWDEEFIKCNWSILFDLTMAANYLLMDSLIDLTCRTVADM
IKGMSVEKIREDFQIKNDFTPEEEKQVRNENSWVFERF
NT seq
477 nt
NT seq
+upstream
nt +downstream
nt
atggcatcgtcttcatccgagaagataataaccctaatgagttcggatggacagacattc
gatgtggaatccgacatcgtcgaatcgcaaagtctgatgatcaagagccttatcaagggt
cacaacttcaccaatggtgttactccgcttaaagttcatgcagatattctgccgcacatt
ctcgattactgcaaaaaacacgccaaacaggatccacctataaatgatgaagaactcaag
aaatgggatgaagaattcatcaaatgtaattggagtatcttgtttgatctgactatggct
gctaattatcttcttatggattctttgattgatttgacttgccgaacagtggccgacatg
attaaaggtatgtctgtggagaaaatcagggaagatttccaaatcaagaatgattttaca
cctgaagaagagaaacaagttcgaaatgagaattcatgggtattcgagagattctga
DBGET
integrated database retrieval system