Amaranthus tricolor (tampala): 130823236
Help
Entry
130823236 CDS
T09367
Name
(RefSeq) SKP1-like protein 7
KO
K03094
S-phase kinase-associated protein 1
Organism
atri
Amaranthus tricolor (tampala)
Pathway
atri03083
Polycomb repressive complex
atri04120
Ubiquitin mediated proteolysis
atri04141
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:
atri00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
130823236
04120 Ubiquitin mediated proteolysis
130823236
09126 Chromosome
03083 Polycomb repressive complex
130823236
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
atri04131
]
130823236
04121 Ubiquitin system [BR:
atri04121
]
130823236
03036 Chromosome and associated proteins [BR:
atri03036
]
130823236
Membrane trafficking [BR:
atri04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
130823236
Ubiquitin system [BR:
atri04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
130823236
Cul7 complex
130823236
Chromosome and associated proteins [BR:
atri03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
130823236
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
130823236
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Skp1_POZ
Motif
Other DBs
NCBI-GeneID:
130823236
NCBI-ProteinID:
XP_057543844
LinkDB
All DBs
Position
9:complement(10580463..10582819)
Genome browser
AA seq
195 aa
AA seq
DB search
MASSSRSCSSSENRNTITLTSSDGLTFEIEENVAVQIKTLRMYLKDLPVNQRKFLVPTVT
GDVLAKVIVYCKKHAENPNRDNPNYIQELKIWDKKFVNENDQYALYDLANAAKDLKVKPL
IDLTYDTVPNMYELPLRSIRGILPKRYDIEFKKIVAFNASLNSNDVPNNVEEAIRDPKWK
KAMEKEMFAFDKNET
NT seq
588 nt
NT seq
+upstream
nt +downstream
nt
atggcatcttcatcaagatcttgttcttcatccgagaacaggaacacgataaccctaacg
agctcagatggattgaccttcgaaatcgaagaaaacgtggcagtgcaaatcaaaacactc
cgtatgtatttaaaagatctgcctgtcaaccaaagaaagtttttggtgccgacagtaacc
ggagatgtactagcgaaagttatcgtctactgtaaaaagcatgcggaaaaccctaatagg
gataaccctaattatattcaagaactcaagatttgggataaaaaatttgtaaacgaaaat
gatcagtatgcactttatgatttagcaaacgctgcaaaagatttgaaagttaagccattg
attgatttgacttacgatactgtaccaaacatgtatgagctaccccttagaagcataagg
ggaattctaccaaagagatatgatatagagttcaagaaaattgtggccttcaatgcttct
cttaactctaacgatgtgcctaacaatgttgaagaggctatcagagatcctaagtggaaa
aaggcaatggagaaggaaatgtttgcttttgataaaaatgaaacatag
DBGET
integrated database retrieval system