Amaranthus tricolor (tampala): 130823237 Help Entry 130823237         CDS       T09367                                  Name (RefSeq) SKP1-like protein 7   KO K03094   S-phase kinase-associated protein 1 Organism atri  Amaranthus tricolor (tampala) Pathway atri03083   Polycomb repressive complex atri04120   Ubiquitin mediated proteolysis atri04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:atri00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     130823237    04120 Ubiquitin mediated proteolysis     130823237   09126 Chromosome    03083 Polycomb repressive complex     130823237  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:atri04131]     130823237    04121 Ubiquitin system [BR:atri04121]     130823237    03036 Chromosome and associated proteins [BR:atri03036]     130823237 Membrane trafficking [BR:atri04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     130823237 Ubiquitin system [BR:atri04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      130823237    Cul7 complex      130823237 Chromosome and associated proteins [BR:atri03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      130823237   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      130823237 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ TUG-UBL1 Motif Other DBs NCBI-GeneID:  130823237 NCBI-ProteinID:  XP_057543845 LinkDB All DBs Position 9:complement(10586984..10587502) Genome browser AA seq 147 aa AA seqDB search MASSSRSCSSSENRNTITLTSSDGLTFEIEENVAVQMKTIRKYLKDLPVNQRKFRVPTVT GHVLAKVIVYCKKHAENPNYIQELKILDKKSVNENDQYALYNLANAAKDLIVKSLMDLTY DTVFACLESNKSRKRIMRFISNCFSWF NT seq 444 nt NT seq  +upstreamnt  +downstreamnt atggcatcttcatcaagatcttgttcttcatccgagaacaggaacacgataaccctaacg agctcagatggattgaccttcgaaatcgaagaaaacgtggcagtgcaaatgaaaacaatc cgtaagtatttaaaagatctgcctgtcaaccaaagaaagtttcgggtgccgacagtcacc ggacatgtactagcgaaagttatcgtctactgcaaaaagcatgcggaaaacccgaattat attcaagaactcaagattttggataaaaaatctgtaaacgaaaatgatcagtatgcactt tataatttagcaaatgctgcaaaagatttgatagttaagtcattgatggatttgacttac gatactgtgtttgcctgcttggaatccaacaagagtaggaagagaattatgaggttcatt tctaattgtttttcttggttttag

DBGET integrated database retrieval system