Amaranthus tricolor (tampala): 130825443 Help Entry 130825443         CDS       T09367                                  Name (RefSeq) polyubiquitin 9-like   KO K03873   elongin-B Organism atri  Amaranthus tricolor (tampala) Pathway atri04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:atri00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     130825443  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:atri04121]     130825443    03400 DNA repair and recombination proteins [BR:atri03400]     130825443 Ubiquitin system [BR:atri04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      130825443    Cul5 complex      130825443 DNA repair and recombination proteins [BR:atri03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      130825443 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ubiquitin Rad60-SLD Dsc3_N UBL_UBAC1 DUF2604 Ubiquitin_2 Motif Other DBs NCBI-GeneID:  130825443 NCBI-ProteinID:  XP_057546663 LinkDB All DBs Position 10:complement(10507220..10510380) Genome browser AA seq 102 aa AA seqDB search MYIRVKRNKSTYFIHCDPTEKVLEIKQKLQGIIDQPVDDQRLILLETGEVLDDSKTLAEE KVENDAVVALTLKKDDDEFEDVNIEKPNDFYQARDSDGGSNW NT seq 309 nt NT seq  +upstreamnt  +downstreamnt atgtatattcgtgttaaacgtaacaagtcaacctactttattcactgtgatcctactgaa aaagttttggaaataaagcagaaattacaaggtattattgaccagcctgttgatgaccag cgattgattctcttagagacaggggaagtactggacgattccaagactttggcagaggag aaggtggagaacgatgctgtggtggcattgaccttgaaaaaagatgacgatgaatttgaa gatgtcaacattgaaaaaccaaatgatttctaccaagctcgtgattcagacggtggttcc aattggtaa

DBGET integrated database retrieval system