Amaranthus tricolor (tampala): 130826201 Help Entry 130826201         CDS       T09367                                  Name (RefSeq) histone H4-like isoform X1   KO K11254   histone H4 Organism atri  Amaranthus tricolor (tampala) Brite KEGG Orthology (KO) [BR:atri00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:atri03036]     130826201 Chromosome and associated proteins [BR:atri03036]  Eukaryotic type   Nucleosome assembly factors    Histones     130826201 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-T_C TAF Histone CBFD_NFYB_HMF TFIID-31kDa CENP-S Motif Other DBs NCBI-GeneID:  130826201 NCBI-ProteinID:  XP_057547764 LinkDB All DBs Position 10:17300870..17301184 Genome browser AA seq 86 aa AA seqDB search MSGRGKGGKGLGKGGPAIHRLTRRGGVKRISGLIYEETRGVLKIFLENVIRDAVTYTEHT RRKTVTAMNVVYALKRQGRTLYGFGG NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atgtcgggaagaggaaaaggaggaaagggattgggaaagggaggacctgcaattcatcgt ttgactcgtagaggaggagttaagagaatcagtggtttgatctacgaagaaactcgtggt gttttgaagattttcttggagaatgtgattcgtgatgctgttacttacactgaacatact agaagaaagactgttactgctatgaatgttgtttacgctcttaagaggcaaggtcgaact ctttatggattcggtggttag

DBGET integrated database retrieval system