KEGG   Aegilops tauschii (wheat D): 109736328
Entry
109736328         CDS       T04345                                 
Name
(RefSeq) SKP1-like protein 1B
  KO
K03094  S-phase kinase-associated protein 1
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats03083  Polycomb repressive complex
ats04120  Ubiquitin mediated proteolysis
ats04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:ats00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    109736328
   04120 Ubiquitin mediated proteolysis
    109736328
  09126 Chromosome
   03083 Polycomb repressive complex
    109736328
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ats04131]
    109736328
   04121 Ubiquitin system [BR:ats04121]
    109736328
   03036 Chromosome and associated proteins [BR:ats03036]
    109736328
Membrane trafficking [BR:ats04131]
 Endosome - Lysosome transport
  Acidification regulators
   RAVE complex
    109736328
Ubiquitin system [BR:ats04121]
 Ubiquitin ligases (E3)
  Multi subunit type E3
   SCF complex
    Adaptor protein
     109736328
   Cul7 complex
     109736328
Chromosome and associated proteins [BR:ats03036]
 Eukaryotic type
  Histone modification proteins
   Polycomb repressive complex (PRC) and associated proteins
    Noncanonical PRC1 (PRC1.1)
     109736328
  Centromeric chromatin formation proteins
   Kinetochore proteins
    CBF3 complex
     109736328
SSDB
Motif
Pfam: Skp1 Skp1_POZ FANCI_S1
Other DBs
NCBI-GeneID: 109736328
NCBI-ProteinID: XP_020151140
LinkDB
Position
5:complement(440478540..440480810)
AA seq 166 aa
MAYAAAATPEKKLMLRSSDGVEFLVEETVAIESQTIKHMVEDDCANNIIPLPNVKAEILT
MVIKYCKQHVQKRGAEPTDSTAKASEWDLKTFDKEFVEVEQRVLFDLILAANYLDIKGLM
DLTCQKVAVMIKKMTPEEIRKTLNIKNDLTKEEVDELRRKNQWAFE
NT seq 501 nt   +upstreamnt  +downstreamnt
atggcgtacgcggcggcggcgacaccggagaagaagctcatgttgaggagctccgacggc
gtggagtttttggtggaggagacggtggctatcgagtcacagaccatcaagcacatggtc
gaggatgactgcgccaacaacatcatccccctccccaacgtcaaagccgagatccttacc
atggtcatcaagtactgcaagcagcacgtccagaagcgcggagctgaacccacagactcc
accgccaaggcctccgagtgggacctcaagaccttcgacaaggagttcgtcgaagtcgaa
caacgcgtcctcttcgacctcatcttggctgcgaactacctggacatcaaggggctgatg
gatcttacctgccagaaggtcgctgtcatgataaagaagatgactccagaggagatccgt
aagaccttaaacatcaagaacgacctcaccaaagaggaagtggatgaactccgaaggaag
aaccagtgggccttcgaatga

DBGET integrated database retrieval system