Aegilops tauschii (wheat D): 109739023
Help
Entry
109739023 CDS
T04345
Name
(RefSeq) translation machinery-associated protein 22
KO
K24272
density-regulated protein
Organism
ats
Aegilops tauschii (wheat D)
Brite
KEGG Orthology (KO) [BR:
ats00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03019 Messenger RNA biogenesis [BR:
ats03019
]
109739023
Messenger RNA biogenesis [BR:
ats03019
]
Eukaryotic type
mRNA surveillance and transport factors
Transport factors
eIF4F and regulatory proteins
109739023
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
SUI1
DENR_N
Motif
Other DBs
NCBI-GeneID:
109739023
NCBI-ProteinID:
XP_020153693
UniProt:
A0A453E5B8
LinkDB
All DBs
Position
3:61522589..61525099
Genome browser
AA seq
201 aa
AA seq
DB search
MAAEKPAPAKVLYCGVCGLPAEYCEFGPDFERCKPWLRAHAPGVYPDELVASSSGGDDKD
VGKVGERLQGVSISTADGSTSAGGASASSKTEEVKRLPGGKLKKKDKQEVIIEKIVRNKR
KCVTVVKGLDLFGVKLSDASKKLGKKFATGASVVKGPTEKEQIDVQGDISYDVVDFITAT
WPDVPESAVYFIEDGRKVAAA
NT seq
606 nt
NT seq
+upstream
nt +downstream
nt
atggcggcggagaagccggccccggcgaaggtgctctactgcggcgtgtgcggcctcccc
gcggagtactgcgagttcggccccgacttcgagcgctgcaagccgtggctccgcgcccac
gcgcccggcgtctaccccgacgagctcgtggcctcctcctccggcggcgacgataaggac
gtgggcaaggtcggcgagcgcctccagggcgtcagcatctccaccgccgacggctccaca
agcgcagggggtgcttcggcatcttctaagactgaagaggtgaagcgactgccgggcggt
aagctcaagaaaaaggacaagcaagaggttattattgagaagattgtccgcaacaagcgc
aagtgtgttactgtggtgaaaggcctggatttgtttggtgtaaagctgagtgatgcttca
aagaagcttggaaagaagtttgctactggagcttcggttgtcaagggcccaactgagaag
gagcaaattgatgtccaaggagacatatcatatgatgttgtggacttcattacagctaca
tggcctgatgttcctgaatctgccgtatatttcatagaagatggaaggaaggttgctgct
gcttga
DBGET
integrated database retrieval system