Aegilops tauschii (wheat D): 109741081 Help Entry 109741081         CDS       T04345                                  Name (RefSeq) uncharacterized protein   KO K03505   DNA polymerase delta subunit 4 Organism ats  Aegilops tauschii (wheat D) Pathway ats03030   DNA replication ats03410   Base excision repair ats03420   Nucleotide excision repair ats03430   Mismatch repair ats03440   Homologous recombination Brite KEGG Orthology (KO) [BR:ats00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     109741081    03410 Base excision repair     109741081    03420 Nucleotide excision repair     109741081    03430 Mismatch repair     109741081    03440 Homologous recombination     109741081  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ats03032]     109741081    03400 DNA repair and recombination proteins [BR:ats03400]     109741081 DNA replication proteins [BR:ats03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     109741081 DNA repair and recombination proteins [BR:ats03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       109741081    MMR (mismatch excision repair)     DNA polymerase delta complex      109741081 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  109741081 NCBI-ProteinID:  XP_045084706 UniProt:  A0A452ZKN2 LinkDB All DBs Position 1:444844309..444845175 Genome browser AA seq 113 aa AA seqDB search MRSGGDVKSFFRQQKAHSGAAATKPTGGVSKKAAHHHQKQAAARPTPDHGGGADAGREDA ERKAREFDMDMRYGPCLGLTRAQRWQRAAALGLAPPPHALCSDDQPCIWEGRV NT seq 342 nt NT seq  +upstreamnt  +downstreamnt atgaggagcggcggcgacgtcaagtccttcttccggcagcagaaggcccactccggcgcg gcggccaccaagcccaccggcggcgtctccaagaaggcggcgcaccaccaccagaagcaa gcggcggcgcgcccgacgccagatcacggcggcggcgccgacgcggggagggaggacgcg gagaggaaggccagggagttcgacatggacatgcgctacgggccctgcctcggcctcacc cgcgcccagcgctggcagcgcgccgccgcgctgggcctcgccccgccgccgcacgcgctc tgctccgacgaccagccgtgcatctgggagggccgcgtctag

DBGET integrated database retrieval system