Aegilops tauschii (wheat D): 109742312 Help Entry 109742312         CDS       T04345                                  Name (RefSeq) uncharacterized protein   KO K03505   DNA polymerase delta subunit 4 Organism ats  Aegilops tauschii (wheat D) Pathway ats03030   DNA replication ats03410   Base excision repair ats03420   Nucleotide excision repair ats03430   Mismatch repair ats03440   Homologous recombination Brite KEGG Orthology (KO) [BR:ats00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     109742312    03410 Base excision repair     109742312    03420 Nucleotide excision repair     109742312    03430 Mismatch repair     109742312    03440 Homologous recombination     109742312  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ats03032]     109742312    03400 DNA repair and recombination proteins [BR:ats03400]     109742312 DNA replication proteins [BR:ats03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     109742312 DNA repair and recombination proteins [BR:ats03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       109742312    MMR (mismatch excision repair)     DNA polymerase delta complex      109742312 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  109742312 NCBI-ProteinID:  XP_020156989 UniProt:  A0A453JU94 LinkDB All DBs Position 5:84269153..84270060 Genome browser AA seq 117 aa AA seqDB search MRSGGDVKSFFRQQKAHSSAAAAKPTSGVSKKPAHHHHQKQAAARPTPDHGDGADARREE AENAERKAREFDMDMRYGPCLGLTRAQRWQRAAALGLAPPPHALCSDDQPCLWEGRV NT seq 354 nt NT seq  +upstreamnt  +downstreamnt atgaggagcggcggcgacgtcaagtccttcttccggcagcagaaggcccactccagcgca gcggccgccaagcccaccagcggcgtctccaagaagccggcgcaccaccaccaccagaag caagcggcggcgcgcccgacgccagatcacggtgacggcgccgacgcgaggagggaggag gcggagaacgcggagaggaaggccagggagttcgacatggacatgcgctacgggccctgc ctcggcctcacccgcgcccagcgctggcagcgcgccgccgcgctgggcctcgccccgccg ccgcacgcgctctgctccgacgaccagccgtgcctctgggagggccgcgtctag

DBGET integrated database retrieval system