Aegilops tauschii (wheat D): 109746243 Help Entry 109746243         CDS       T04345                                  Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism ats  Aegilops tauschii (wheat D) Pathway ats04145   Phagocytosis ats04517   IgSF CAM signaling ats04814   Motor proteins Brite KEGG Orthology (KO) [BR:ats00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     109746243  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     109746243   09142 Cell motility    04814 Motor proteins     109746243  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ats03037]     109746243    04812 Cytoskeleton proteins [BR:ats04812]     109746243 Cilium and associated proteins [BR:ats03037]  Motile cilia and associated proteins   Dynein arm    109746243 Cytoskeleton proteins [BR:ats04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      109746243 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light DUF6636 Motif Other DBs NCBI-GeneID:  109746243 NCBI-ProteinID:  XP_020160953 LinkDB All DBs Position 7 Genome browser AA seq 104 aa AA seqDB search MLEGKATVEDTDMPAKMQLQATLAASRALDRFDILDCRSIAAHIKKTAALQEFDTIHGPG WQCVVGCSFGCYFTHSKGRFIYFKFELLRFLVFKGMANEQPLPC NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgctggaagggaaggcgacggtggaggacaccgacatgccggccaagatgcagctgcag gccacgttggcggcgtccagggcgctcgaccgcttcgacatcctcgactgccggagcatc gcggcgcacatcaagaagacggctgcactacaagagttcgacacgatccatggcccgggg tggcagtgcgtggtgggctgcagcttcggctgctacttcacgcacagcaaggggaggttc atatacttcaagttcgagttgctcaggttcctcgtcttcaaaggcatggcgaatgagcaa ccgctaccgtgctga

DBGET integrated database retrieval system