Aegilops tauschii (wheat D): 109746266 Help Entry 109746266         CDS       T04345                                  Name (RefSeq) rac-like GTP-binding protein 6   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism ats  Aegilops tauschii (wheat D) Pathway ats04145   Phagosome ats04148   Efferocytosis ats04620   Toll-like receptor signaling pathway ats05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:ats00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     109746266    04148 Efferocytosis     109746266  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109746266  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     109746266  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ats04131]     109746266   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ats04147]     109746266    04031 GTP-binding proteins [BR:ats04031]     109746266 Membrane trafficking [BR:ats04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     109746266  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     109746266   Macropinocytosis    Ras GTPases     109746266  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     109746266 Exosome [BR:ats04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109746266   Exosomal proteins of other body fluids (saliva and urine)    109746266   Exosomal proteins of colorectal cancer cells    109746266   Exosomal proteins of bladder cancer cells    109746266 GTP-binding proteins [BR:ats04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     109746266 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  109746266 NCBI-ProteinID:  XP_020160974 UniProt:  A0A453N1J2 LinkDB All DBs Position 6D:43871191..43874785 Genome browser AA seq 197 aa AA seqDB search MSASRFIKCVTVGDGAVGKTCMLISYTSNTFPTDYVPTVFDNFSANVVVDGNTVNLGLWD TAGQEDYNRLRPLSYRGADVFLLAFSLISKASYENVSKKWIPELKHYAPGVPIILVGTKL DLRDDKQFFVDHPGAVPITTAQGEELKKLIGAPYYIECSSKTQLNVKGVFDAAIKVVLAP PKAKKKKKAQRGACSIL NT seq 594 nt NT seq  +upstreamnt  +downstreamnt atgagcgcgtccaggttcataaagtgcgtcaccgtgggggacggcgccgtcggcaagact tgcatgctcatctcctacacctccaacaccttccccaccgactatgtgccaacggtgttt gacaacttcagtgctaatgttgtggttgatggcaacactgtcaacctcgggctatgggat actgcaggtcaggaggactacaacagactgagaccgctgagttatcgtggagctgatgtc ttccttctggccttctcgcttatcagcaaggccagctatgagaatgtttcaaagaagtgg atacctgagctgaagcattatgcaccaggtgtgcctattatccttgtgggaacaaagctt gatcttcgagatgacaagcagttctttgtggaccatcctggtgctgttcctatcactact gctcagggggaggaactaaaaaagttaataggcgcaccctactacatcgaatgcagctcg aagacccaactaaatgtcaagggtgtatttgatgcggcaataaaggtggtacttgcgcca ccaaaggcgaagaagaagaaaaaggcgcagaggggggcttgctccatcttgtga

DBGET integrated database retrieval system