KEGG   Aegilops tauschii (wheat D): 109757929
Entry
109757929         CDS       T04345                                 
Name
(RefSeq) indole-2-monooxygenase-like
  KO
K13223  indole-2-monooxygenase [EC:1.14.14.153]
Organism
ats  Aegilops tauschii (wheat D)
Pathway
ats00402  Benzoxazinoid biosynthesis
ats00999  Biosynthesis of various plant secondary metabolites
ats01100  Metabolic pathways
ats01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ats00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00402 Benzoxazinoid biosynthesis
    109757929
   00999 Biosynthesis of various plant secondary metabolites
    109757929
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:ats00199]
    109757929
Enzymes [BR:ats01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.153  indole-2-monooxygenase
     109757929
Cytochrome P450 [BR:ats00199]
 Cytochrome P450, plant type
  CYP71 family
   109757929
SSDB
Motif
Pfam: p450
Other DBs
NCBI-GeneID: 109757929
NCBI-ProteinID: XP_020172363
LinkDB
Position
Unknown
AA seq 528 aa
MAHVHVDEMLHEAAPAAPRSLLIATAVLFSLVVVPLLLRIITKQGAASDAKLLSLLPSPP
TRLPIIGHLHLMGDLPYVSLAGLAAKYGPELMLVHLGAVPTAVVSSPRTAEAVLRTHDHI
FASRPRSMVFDIIMYGQTDSCFAPYGEHFRKARKLVTVHMLNARKIRSQRPAREEEVRLV
IGKIAKAAAAREAVDMSELLHSYVNDLVCRAVSGKFSQEEGRNKLFRELTDINAALLGGF
NILDYFPSLGRFELVCKVACAKARRVRKRWDLLLDKLIDDHAARMVSREDEAQPEQEEDK
DFIDVSLSLQQEYGLTRHHIKAILIDMFEAGTDTSYMTLEFAMAELIRKPHLMKKLQEEV
RRNVTNGQEMVAEDDLPNMTYLKAVIKETLRLHPPVPLMIPHFSLDACTVDGYTIPANTR
VVINAWALGRHSGYWENENEFQPERFMNGAGVDLKPNEFHYLPFGFGRRMCPGVHSASAT
VETMLANLMYRFDWKLPPGLKEENIDMTEVFGITVSRKEKLILVPVTA
NT seq 1587 nt   +upstreamnt  +downstreamnt
atggctcacgtacatgtagacgagatgctccacgaagcagcaccggcagctccacgatct
ctcttgattgcgactgcggtgctcttctcccttgtggttgtgccgctcctgctccgcatt
attaccaagcagggagcggcaagcgacgccaagctgctgagcctgctcccatctcccccg
acgaggctccccataatcgggcacctacacctaatgggcgatcttccctacgtctccctc
gccggcctggccgccaagtacggcccggaactcatgctggtacacctcggtgccgtgccc
accgccgtcgtgtcctcgccgcgcactgccgaggccgtcctgcgcacccacgaccacatc
ttcgcgtcgcgaccgcggtcgatggtcttcgacatcatcatgtacgggcagacggactcg
tgcttcgcgccctacggcgagcacttccggaaggccaggaagctcgtgacggtgcacatg
ctcaacgccaggaagatacggtcccagcgcccggcccgggaggaggaggtccggctagtg
attggaaagatcgccaaggccgcggccgcgcgcgaggccgtagacatgagcgagctcctg
cactcgtacgtcaacgacctcgtttgccgtgctgtgtcgggcaagttctcccaggaggag
gggcggaacaagctgttccgtgagctcaccgacatcaacgcggcgctcctgggagggttc
aacatcctcgactacttcccgagcctggggaggttcgagttggtctgcaaggtggcgtgc
gccaaggcccgacgggtgaggaagcggtgggacctgctcctcgacaagctaattgacgac
catgcagcaaggatggtaagccgtgaggatgaggcccagccggagcaagaagaagacaaa
gacttcatcgacgtatccctatctcttcagcaggagtatggtctcaccaggcaccatatc
aaggccatcttgatagacatgtttgaggccggcacggacacctcgtatatgacgctggag
tttgccatggcggagctcatacggaagccacaccttatgaagaagctgcaggaagaggta
aggaggaatgtaaccaacgggcaagagatggtcgccgaagacgatctccccaacatgacc
tacctcaaggctgtcatcaaggagacactccgactgcatccgccggtacctctcatgatt
ccacacttctccctagatgcctgcaccgttgatggctacacgatcccagcaaacactcgt
gtcgttatcaacgcctgggcactcggcaggcacagtggctactgggaaaatgaaaatgaa
ttccaacctgagagatttatgaatggagccggcgttgatctgaagccaaatgagttccat
tacttgccatttgggtttggacgaagaatgtgccctggggttcactcggcatcagcaacg
gtcgagacaatgctggcaaacctcatgtaccgattcgattggaagcttccacccggattg
aaggaagaaaacatagatatgactgaggtgtttggaattacagtttcaagaaaggaaaag
ctcatcttagtccccgtgaccgcatga

DBGET integrated database retrieval system