Aegilops tauschii (wheat D): 109761271 Help Entry 109761271         CDS       T04345                                  Name (RefSeq) rac-like GTP-binding protein 4   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism ats  Aegilops tauschii (wheat D) Pathway ats04145   Phagosome ats04148   Efferocytosis ats04620   Toll-like receptor signaling pathway ats05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:ats00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     109761271    04148 Efferocytosis     109761271  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109761271  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     109761271  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ats04131]     109761271   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ats04147]     109761271    04031 GTP-binding proteins [BR:ats04031]     109761271 Membrane trafficking [BR:ats04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     109761271  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     109761271   Macropinocytosis    Ras GTPases     109761271  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     109761271 Exosome [BR:ats04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109761271   Exosomal proteins of other body fluids (saliva and urine)    109761271   Exosomal proteins of colorectal cancer cells    109761271   Exosomal proteins of bladder cancer cells    109761271 GTP-binding proteins [BR:ats04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     109761271 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Motif Other DBs NCBI-GeneID:  109761271 NCBI-ProteinID:  XP_020175658 UniProt:  A0A453R798 LinkDB All DBs Position 7D:148555901..148560019 Genome browser AA seq 213 aa AA seqDB search MASSASRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYVPTVFDNFSANVVVDGTTVNLGL WDTAGQEDYNRLRPLSYRGADVFVLAFSLVSRASYENIMKKWLPELQHHAPSVPIVLVGT KYDLREDKQYLLDHPGVVPVTAAQGEELRKHIGATCYVECSSKTQQNVKAVFDAAIKVVI KPPTKQRERKKKKARQGCASLGVLSRRKLACFK NT seq 642 nt NT seq  +upstreamnt  +downstreamnt atggcgtccagcgcctcccggttcatcaagtgcgtgacggtcggcgacggcgccgtcggc aagacctgcatgctcatctgctacaccagcaacaagttccccaccgactatgtacccacc gtgttcgacaatttcagcgccaacgtggtggtggacggcaccaccgtgaacctgggcctc tgggacactgcagggcaggaggattacaacagactgagaccgctgagctaccggggagcc gacgtcttcgtgctcgccttctcgctcgtcagccgcgccagctacgagaacatcatgaag aagtggctaccggagcttcagcaccatgcgcccagcgtgccgatagtgttggttggtaca aaatatgatctccgtgaagacaaacaatacttgcttgaccatcctggcgttgtgcctgtt actgcagctcagggggaggaactccgcaagcacattggcgcaacctgctacgtcgaatgc agctcaaagacacagcagaatgtcaaagctgtgtttgatgctgccatcaaagtagtgatc aagcctccaacaaagcagagggaaaggaagaagaagaaagcacggcaaggatgtgcatca ttgggtgtcctgtctagaaggaaactggcatgcttcaagtga

DBGET integrated database retrieval system