Aegilops tauschii (wheat D): 109764311 Help Entry 109764311         CDS       T04345                                  Name (RefSeq) calmodulin-like protein 4   KO K02183   calmodulin Organism ats  Aegilops tauschii (wheat D) Pathway ats04016   MAPK signaling pathway - plant ats04070   Phosphatidylinositol signaling system ats04075   Plant hormone signal transduction ats04626   Plant-pathogen interaction Brite KEGG Orthology (KO) [BR:ats00001]  09130 Environmental Information Processing   09132 Signal transduction    04016 MAPK signaling pathway - plant     109764311    04070 Phosphatidylinositol signaling system     109764311    04075 Plant hormone signal transduction     109764311  09150 Organismal Systems   09159 Environmental adaptation    04626 Plant-pathogen interaction     109764311  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:ats01009]     109764311   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ats04131]     109764311    03036 Chromosome and associated proteins [BR:ats03036]     109764311   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ats04147]     109764311 Protein phosphatases and associated proteins [BR:ats01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      109764311 Membrane trafficking [BR:ats04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     109764311 Chromosome and associated proteins [BR:ats03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      109764311 Exosome [BR:ats04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    109764311 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_5 EF-hand_8 EF-hand_9 AIF-1 CFAP251_C EF-hand_FSTL1 EF_EFCAB10_C EH SPARC_Ca_bdg Allatotropin-like_C Dockerin_1 SAPC2_N DUF5580_M EF-hand_11 EF-hand_EFHB_C Caleosin EF-hand_SWAP70_N TerB MTIP_N SUB1_ProdP9 PA_Ig-like EF-hand_STIM1 TP_0584_C Motif Other DBs NCBI-GeneID:  109764311 NCBI-ProteinID:  XP_020178740 UniProt:  A0A453LSC2 LinkDB All DBs Position 5:475572623..475574597 Genome browser AA seq 155 aa AA seqDB search MEQALTGEQMVAFQEAFSLFDKNGDGCISLEELAAVTRSLGLDPTNQELNDMMREVDMDG NGTIDFQEFLSLIARKMQDGDADEELKEAFEVLDKDRNGFISPVELRTVMINLGEKMTDE EVEQMIREADTDGDGQVNYDEFVLMMKNAERKITG NT seq 468 nt NT seq  +upstreamnt  +downstreamnt atggaacaggcgctgacgggcgagcagatggtggcgttccaggaggccttctccctcttc gacaagaacggcgatggatgcatcagcttggaagagctggccgcggtgactcgctccctc ggcctcgacccgaccaaccaggagctcaatgacatgatgcgtgaagtcgacatggatggg aacggcaccattgatttccaggagttcttgagcctcattgccaggaagatgcaggacgga gacgccgacgaagagctcaaggaagctttcgaggtcctggacaaggatcgaaatggtttc atctcccctgttgagctgaggacggtgatgatcaatctcggggagaagatgaccgacgag gaggtcgagcagatgatcagggaggcggacaccgatggtgacgggcaggtgaactacgat gaattcgtgctcatgatgaagaatgctgagcgcaagataactgggtga

DBGET integrated database retrieval system