Aegilops tauschii (wheat D): 109765051 Help Entry 109765051         CDS       T04345                                  Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism ats  Aegilops tauschii (wheat D) Pathway ats04145   Phagocytosis ats04517   IgSF CAM signaling ats04814   Motor proteins Brite KEGG Orthology (KO) [BR:ats00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     109765051  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     109765051   09142 Cell motility    04814 Motor proteins     109765051  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ats03037]     109765051    04812 Cytoskeleton proteins [BR:ats04812]     109765051 Cilium and associated proteins [BR:ats03037]  Motile cilia and associated proteins   Dynein arm    109765051 Cytoskeleton proteins [BR:ats04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      109765051 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light Motif Other DBs NCBI-GeneID:  109765051 NCBI-ProteinID:  XP_020179426 UniProt:  A0A452YS22 LinkDB All DBs Position 1 Genome browser AA seq 99 aa AA seqDB search MLEGKATVEDTDMPAKMQLQATSAASRALDRFDVLDCRSIAAHIKKEFDTIHGPGWQCVV GCSFGCYFTHSKGSFIYFKFELLRFLVFKGMADEQPLPC NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgctggaagggaaggcgacggtggaggacaccgacatgccggccaagatgcagctgcag gccacgtcggcggcgtcgagggcactcgaccgcttcgacgtcctcgactgccggagcatc gcggcgcacatcaagaaggagttcgacacgatccatggcccggggtggcagtgcgtggtg ggctgcagcttcggctgctacttcacgcacagcaaggggagcttcatatacttcaagttc gagttgctcaggttcctcgtcttcaaaggcatggcggatgagcaaccgctgccgtgctga

DBGET integrated database retrieval system