Aegilops tauschii (wheat D): 109768388 Help Entry 109768388         CDS       T04345                                  Name (RefSeq) SKP1-like protein 1   KO K03094   S-phase kinase-associated protein 1 Organism ats  Aegilops tauschii (wheat D) Pathway ats03083   Polycomb repressive complex ats04120   Ubiquitin mediated proteolysis ats04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ats00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     109768388    04120 Ubiquitin mediated proteolysis     109768388   09126 Chromosome    03083 Polycomb repressive complex     109768388  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ats04131]     109768388    04121 Ubiquitin system [BR:ats04121]     109768388    03036 Chromosome and associated proteins [BR:ats03036]     109768388 Membrane trafficking [BR:ats04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     109768388 Ubiquitin system [BR:ats04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      109768388    Cul7 complex      109768388 Chromosome and associated proteins [BR:ats03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      109768388   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      109768388 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 Motif Other DBs NCBI-GeneID:  109768388 NCBI-ProteinID:  XP_020182699 UniProt:  A0A453MQZ9 LinkDB All DBs Position 6:8763446..8764848 Genome browser AA seq 156 aa AA seqDB search MATAEAGENKMIMLISSDGMEFEVEEAIAMESQTIRQMIEDECAGKGIPIPNINSKILSR VIEYCNKHVPTMPTTGATGAATSDTVAPAALAEDLKIWDREFIKVNRATLLDLNQAASYL NIKGLLDLTCQTTDTISGHNLEELRSFLQHQERLLA NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atggcgaccgcagaggcaggcgagaacaagatgatcatgctcatatcgtctgacggcatg gagttcgaggtagaggaggcaatcgccatggagtcgcagaccatccgccaaatgatcgag gatgagtgcgccggcaaaggcattccgatccccaacatcaactccaagatcctctccagg gtcatcgagtactgcaacaaacacgtcccgaccatgccaaccactggagccaccggtgcc gccacgtctgacaccgtggctcccgccgccctagccgaggacctcaagatctgggacaga gaattcatcaaggtcaaccgtgccaccctcttagatctcaaccaggctgcaagttacctc aacatcaaggggttgttggacctgacttgccagactaccgacacgattagtggccataat ctggaggagctccgtagtttccttcagcatcaagaacgactacttgcctga

DBGET integrated database retrieval system