Aegilops tauschii (wheat D): 109770258
Help
Entry
109770258 CDS
T04345
Name
(RefSeq) ABC transporter F family member 1
KO
K06185
ATP-binding cassette, subfamily F, member 2
Organism
ats
Aegilops tauschii (wheat D)
Brite
KEGG Orthology (KO) [BR:
ats00001
]
09180 Brite Hierarchies
09182 Protein families: genetic information processing
03009 Ribosome biogenesis [BR:
ats03009
]
109770258
Ribosome biogenesis [BR:
ats03009
]
Eukaryotic type
Pre-60S particles
Export and cytoplasmic maturation factors
109770258
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
ABC_tran
ABC_tran_Xtn
AAA_21
SMC_N
AAA_29
AAA_23
AAA_22
AAA_15
MMR_HSR1
AAA_14
RsgA_GTPase
AAA_33
AAA_28
AAA_27
AAA_16
AAA_30
Ig_F54D1_6_2
AAA_24
Motif
Other DBs
NCBI-GeneID:
109770258
NCBI-ProteinID:
XP_020184554
UniProt:
A0A453GXP2
LinkDB
All DBs
Position
4:134239..138605
Genome browser
AA seq
595 aa
AA seq
DB search
MVSDASKKKAAQKKAAAAAKRGAKVPASSSSASSSASANKTGALAAVQLSDRTCTAVLTS
HPLSRDIHIESLTLTFHGHDLLVDTELELNYGRRYGLLGLNGCGKSCLLKAIGCRELPIP
EHMDIYHLSHEIEASDMSALGAVISCDEERVKLEKEAEVLAAQDDGGGAALERVYERLEA
IDASTAEKRAAEILFGLGFNKQMQAKKTRDFSGGWRMRIALARALFMNPTILLLDEPTNH
LDLEACVWLEETLKKFDRILVVISHSQDFLNGVCTNIIHMQNRKLKLYTGNFDQYVQTRS
ELEENQMKQYRWEQDQIASMKEYIARFGHGSAKLARQAQSKEKTLAKMERGGLTEKVARD
RILTFRFANVGKLPPPVLQFVEVTFGYTPDNLIYKKLDFGVDLDSRVALVGPNGAGKSTL
LKLMTGELVPLDGMVRRHNHLRIAQFHQHLAEKLDLDLSALQYMLNEYPGNEEERMRAAI
GRFGLSGKAQVMPMRNLSDGQRSRVIFAWLAWREPQMLLLDEPTNHLDIETIDSLAEALK
EWDGGLVLVSHDFRLINQVAQEIWVCEKQAVTRWEGDIMEFKEHLKSKSGGMSED
NT seq
1788 nt
NT seq
+upstream
nt +downstream
nt
atggtgtcggacgccagcaagaagaaggcggcgcagaagaaggccgccgcagccgcaaag
aggggcgccaaggtgcccgcctcctcctcctccgcatcatcttccgcctccgccaacaag
acgggggccctcgccgccgtccagctgtcggaccgcacctgcaccgccgtcctcacctcc
cacccgctctcccgcgacatacacatagagtctctcactttaacattccacggccacgat
ctacttgtagacactgagctggagctcaactacggcaggcgctatggtttgcttggtctg
aatggctgcggcaagtcctgccttctcaaagcaatagggtgcagggagcttcctatccca
gagcacatggacatataccacctcagccatgagatcgaggcttcagacatgtctgcactt
ggagctgtcattagctgtgatgaagaaagggtcaagctcgaaaaagaagctgaagttttg
gctgctcaagatgatggcggcggtgcagctttggagcgcgtatatgagcggctagaagca
attgatgcatccaccgctgaaaagcgtgctgctgagattttgtttggcttaggctttaac
aagcagatgcaggccaagaaaactagggacttttctggcggctggcgcatgaggattgct
ttggcaagagctctcttcatgaatccaaccatccttttgctcgatgagcctaccaatcat
ctcgatcttgaggcatgcgtgtggctggaagaaacgctgaagaaatttgaccgtatactt
gttgtgatatcacactcccaagacttcctgaatggagtatgtaccaacatcatccacatg
cagaacaggaagctgaagctgtacactgggaatttcgaccagtatgtgcaaacgcggtct
gagctggaggagaaccagatgaagcagtacaggtgggagcaggaccagatcgcgtcgatg
aaggagtacatcgcacgcttcgggcacgggtccgccaagctggcacggcaggcccagagc
aaggagaagactctggccaagatggagcgtggcgggctgacggagaaggtggcgagggac
aggatcctgacgttccggttcgccaacgtgggcaagctcccgccgccggtgctgcagttt
gtggaggtgacgttcgggtacacgccggacaacctgatctacaagaagctggactttggc
gtggacctggactcacgggttgcgctggtggggccgaacggggctgggaagagcacgctg
ctgaagctgatgacgggggagctggtgccgctggacgggatggtgcgtcggcacaaccac
ctgcgtatcgcgcagttccaccagcacctggcggagaagctggacctggacctgtctgcg
ctgcagtacatgctgaacgagtacccgggcaacgaggaggagcggatgcgggcggccatc
gggcggttcgggctgtcgggcaaggcgcaggtgatgccgatgcgcaacctgtcggacggg
cagcggagccgggtgatcttcgcgtggctggcgtggcgtgagccgcagatgctgctgctg
gacgagccgacgaaccacctggacattgagacgatcgactcgctggcggaggcgctgaag
gagtgggacggcgggctggtgctggtgagccatgacttcaggctgatcaaccaggtggcg
caggagatctgggtgtgcgagaagcaggcggtgacgaggtgggagggcgacatcatggag
ttcaaggagcacctgaagagcaagtcgggcggcatgtcggaggactga
DBGET
integrated database retrieval system