Aegilops tauschii (wheat D): 109770849 Help Entry 109770849         CDS       T04345                                  Name (RefSeq) rac-like GTP-binding protein 3   KO K04392   Ras-related C3 botulinum toxin substrate 1 Organism ats  Aegilops tauschii (wheat D) Pathway ats04145   Phagosome ats04148   Efferocytosis ats04620   Toll-like receptor signaling pathway ats05100   Bacterial invasion of epithelial cells Brite KEGG Orthology (KO) [BR:ats00001]  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagosome     109770849    04148 Efferocytosis     109770849  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     109770849  09160 Human Diseases   09171 Infectious disease: bacterial    05100 Bacterial invasion of epithelial cells     109770849  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ats04131]     109770849   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:ats04147]     109770849    04031 GTP-binding proteins [BR:ats04031]     109770849 Membrane trafficking [BR:ats04131]  Exocytosis   Small GTPases and associated proteins    Rho GTPases     109770849  Endocytosis   Lipid raft mediated endocytosis    Arf6-dependent endocytosis     109770849   Macropinocytosis    Ras GTPases     109770849  Others   NADPH oxidases (Nox) and associated proteins    Nox associated proteins     109770849 Exosome [BR:ats04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    109770849   Exosomal proteins of other body fluids (saliva and urine)    109770849   Exosomal proteins of colorectal cancer cells    109770849   Exosomal proteins of bladder cancer cells    109770849 GTP-binding proteins [BR:ats04031]  Small (monomeric) G-proteins   Rho Family    Rac/Cdc42 [OT]     109770849 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU Sua5_C Gtr1_RagA Motif Other DBs NCBI-GeneID:  109770849 NCBI-ProteinID:  XP_020185150 UniProt:  A0A453PKN8 LinkDB All DBs Position 6:423781736..423785044 Genome browser AA seq 213 aa AA seqDB search MASSASRFIKCVTVGDGAVGKTCMLICYTSNKFPTDYIPTVFDNFSANVVADGTTVNLGL WDTAGQEDYNRLRPLSYRGADVFVLAFSLVSRASYENIMKKWIPELQHYAPGVPVVLVGT KLDLREDKHYLLDHPGMIPVTTAQGEELRKQVGALYYIECSSKTQQNVKAVFDAAIKVVI QPPTKQREKKKKKQRRGCSMMNFGGRKMLCFKS NT seq 642 nt NT seq  +upstreamnt  +downstreamnt atggcgtccagcgcttcccggttcatcaagtgcgtcacggtgggcgacggcgccgtcggc aagacctgcatgctcatctgctacaccagcaacaagttccccaccgactacatacccacg gtgttcgacaatttcagcgcaaacgtggtagcggacggcaccacggtgaatttgggcctt tgggataccgccgggcaggaggattacaaccggctgaggcctctgagctaccgcggcgct gacgtttttgtgcttgccttctctcttgtgagccgagctagctatgagaacatcatgaag aagtggataccggagcttcagcattacgcgcccggcgtgccggttgtgctggtaggcaca aaactggatcttcgtgaagacaagcactatttgctggaccaccctggcatgatacctgtt accacagcacagggggaggaacttcgtaagcaagtcggtgctttatattacatagagtgc agctcaaagacacaacagaatgtcaaagctgtgtttgatgctgctatcaaggtagtaatc cagcccccaactaaacaaagagaaaagaagaaaaagaagcagcgtcgtggatgctctatg atgaacttcggtggaaggaaaatgctatgcttcaaatcctga

DBGET integrated database retrieval system