Aegilops tauschii (wheat D): 109780380
Help
Entry
109780380 CDS
T04345
Name
(RefSeq) SKP1-like protein 11
KO
K03094
S-phase kinase-associated protein 1
Organism
ats
Aegilops tauschii (wheat D)
Pathway
ats03083
Polycomb repressive complex
ats04120
Ubiquitin mediated proteolysis
ats04141
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:
ats00001
]
09120 Genetic Information Processing
09123 Folding, sorting and degradation
04141 Protein processing in endoplasmic reticulum
109780380
04120 Ubiquitin mediated proteolysis
109780380
09126 Chromosome
03083 Polycomb repressive complex
109780380
09180 Brite Hierarchies
09182 Protein families: genetic information processing
04131 Membrane trafficking [BR:
ats04131
]
109780380
04121 Ubiquitin system [BR:
ats04121
]
109780380
03036 Chromosome and associated proteins [BR:
ats03036
]
109780380
Membrane trafficking [BR:
ats04131
]
Endosome - Lysosome transport
Acidification regulators
RAVE complex
109780380
Ubiquitin system [BR:
ats04121
]
Ubiquitin ligases (E3)
Multi subunit type E3
SCF complex
Adaptor protein
109780380
Cul7 complex
109780380
Chromosome and associated proteins [BR:
ats03036
]
Eukaryotic type
Histone modification proteins
Polycomb repressive complex (PRC) and associated proteins
Noncanonical PRC1 (PRC1.1)
109780380
Centromeric chromatin formation proteins
Kinetochore proteins
CBF3 complex
109780380
BRITE hierarchy
SSDB
Ortholog
Paralog
Gene cluster
GFIT
Motif
Pfam:
Skp1
Skp1_POZ
BetR
Motif
Other DBs
NCBI-GeneID:
109780380
NCBI-ProteinID:
XP_020194582
UniProt:
A0A452YAS6
LinkDB
All DBs
Position
1:200316754..200318813
Genome browser
AA seq
238 aa
AA seq
DB search
MDSTADFKGKRPLFQPDDVSAAAAAVAVPDEAEAEAKPSSSSEEVKEPEPGTEKQEEKPA
LVLVAEDGVEVRISEPAARMSQTLRHMMEDGCADGRIPTANIHSDILEMVVEYCEKHGPY
YDPEASERDRYPFPPFPIELTPTVSSIKPVTYVDPDPHGLKDWDSDFISLDNSTLFEIIL
AANYLNIEDLLDLGTSAVADKMRGKKPEEIREIFEIENDYTPEQEAEVRKENAWAFED
NT seq
717 nt
NT seq
+upstream
nt +downstream
nt
atggattccactgccgacttcaagggcaagcgccctctcttccagcctgatgacgtgtct
gccgccgccgctgcagtggcggtgccggatgaggcggaggcggaggcgaagccctcgtct
tcttcggaggaggtaaaggagccggagccggggacagagaagcaggaggagaaacccgcc
ctggtgctggtggccgaggacggcgtggaggtgcgcatctcggagcccgcggcgcggatg
tcgcagacgctccgccacatgatggaggacggctgcgctgacggccgcatcccaaccgcc
aacatccactccgacatcctcgagatggtcgttgagtactgcgagaagcacgggccgtac
tacgaccccgaggcctctgagcgcgaccggtatcccttcccgcccttccccatcgagctc
acccctaccgtctcctccatcaagcccgtcacctacgtcgacccggacccccacggtctc
aaggactgggacagcgatttcatctccctcgataactccaccctcttcgagatcatcctg
gccgcaaactacctgaacattgaggatctgctagacctgggcacctcggctgtggctgac
aagatgagggggaaaaagccagaggagatccgcgaaatctttgagatcgagaacgactac
acaccagagcaggaggctgaagtcaggaaggagaacgcatgggcctttgaggactaa
DBGET
integrated database retrieval system