Aegilops tauschii (wheat D): 109780536 Help Entry 109780536         CDS       T04345                                  Name (RefSeq) uncharacterized protein   KO K03505   DNA polymerase delta subunit 4 Organism ats  Aegilops tauschii (wheat D) Pathway ats03030   DNA replication ats03410   Base excision repair ats03420   Nucleotide excision repair ats03430   Mismatch repair ats03440   Homologous recombination Brite KEGG Orthology (KO) [BR:ats00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     109780536    03410 Base excision repair     109780536    03420 Nucleotide excision repair     109780536    03430 Mismatch repair     109780536    03440 Homologous recombination     109780536  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:ats03032]     109780536    03400 DNA repair and recombination proteins [BR:ats03400]     109780536 DNA replication proteins [BR:ats03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     109780536 DNA repair and recombination proteins [BR:ats03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       109780536    MMR (mismatch excision repair)     DNA polymerase delta complex      109780536 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  109780536 NCBI-ProteinID:  XP_020194712 UniProt:  A0A453LCI3 LinkDB All DBs Position 5:complement(423223111..423225295) Genome browser AA seq 131 aa AA seqDB search MASTGVKDFYRQKKKGGVGKTSASSKKKTQNYTGGASVGASNKAQTAALISHGSLDLKDD FSEQEEQLRQFDMDMKFGPCIGVNRLQRWERASAMGLQPPPHLRDLLARASSGNNRNNGG PSPECLWEGKI NT seq 396 nt NT seq  +upstreamnt  +downstreamnt atggcttctactggcgtgaaagatttctaccggcagaagaagaaaggaggtgtcggcaaa acttcagcatcttccaagaagaaaacacagaattacactggaggggcctctgttggggcc tcgaataaggctcagacagcagcactaatttctcacggatccttagacctcaaagatgat ttcagtgagcaagaggagcagctgcggcagtttgacatggacatgaagtttggcccgtgc atcggtgtcaaccggcttcagcgctgggagcgtgcttccgccatgggcctccagccaccg ccccaccttcgtgatctcctagcgcgcgcctcctccggaaacaaccgcaacaacggcggc ccctcccctgagtgcctctgggagggtaagatctag

DBGET integrated database retrieval system