Aegilops tauschii (wheat D): 109783289 Help Entry 109783289         CDS       T04345                                  Name (RefSeq) uncharacterized protein   KO K10418   dynein light chain LC8-type Organism ats  Aegilops tauschii (wheat D) Pathway ats04145   Phagocytosis ats04517   IgSF CAM signaling ats04814   Motor proteins Brite KEGG Orthology (KO) [BR:ats00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04517 IgSF CAM signaling     109783289  09140 Cellular Processes   09141 Transport and catabolism    04145 Phagocytosis     109783289   09142 Cell motility    04814 Motor proteins     109783289  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    03037 Cilium and associated proteins [BR:ats03037]     109783289    04812 Cytoskeleton proteins [BR:ats04812]     109783289 Cilium and associated proteins [BR:ats03037]  Motile cilia and associated proteins   Dynein arm    109783289 Cytoskeleton proteins [BR:ats04812]  Eukaryotic cytoskeleton proteins   Microtubules    Tubulin-binding proteins     Dyneins      109783289 SSDB OrthologParalogGFIT Motif Pfam:  Dynein_light ECH_2 Ago_N_3 Motif Other DBs NCBI-GeneID:  109783289 NCBI-ProteinID:  XP_020197491 LinkDB All DBs Position 3 Genome browser AA seq 141 aa AA seqDB search MSDELKRGIAGAAAVAASHPAPYAPRAPADADRRLAASATASLGSPPPAAASPTAHKITL KSADMKEEMQKEAFDISRVAFEKHTMEKDIAEYIKKEFDKNHGPTWHCIVGRNFGSYVTH ETNYFVYFYIDSKAVLLFKSG NT seq 426 nt NT seq  +upstreamnt  +downstreamnt atgtccgacgagctcaagcgcgggatcgcgggcgccgccgccgtcgccgcctcccacccg gcgccctacgcgccgcgggccccggccgacgccgaccgcaggctcgccgcctccgccacc gcctcgctgggctccccgccgccggccgccgcgtcgcccacggcgcacaagatcacgctc aagagcgccgacatgaaggaggagatgcagaaggaggcgttcgacatctcccgcgtcgcg ttcgagaagcacaccatggagaaggacatcgcggagtacatcaagaaggagttcgacaag aaccacggccccacctggcactgcatcgtcggccgcaacttcggttcctatgtgacgcac gagacgaactactttgtgtatttctacattgattctaaagctgtcttgctatttaagtct gggtga

DBGET integrated database retrieval system