Aegilops tauschii (wheat D): 109783394 Help Entry 109783394         CDS       T04345                                  Name (RefSeq) SKP1-like protein 1   KO K03094   S-phase kinase-associated protein 1 Organism ats  Aegilops tauschii (wheat D) Pathway ats03083   Polycomb repressive complex ats04120   Ubiquitin mediated proteolysis ats04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:ats00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     109783394    04120 Ubiquitin mediated proteolysis     109783394   09126 Chromosome    03083 Polycomb repressive complex     109783394  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:ats04131]     109783394    04121 Ubiquitin system [BR:ats04121]     109783394    03036 Chromosome and associated proteins [BR:ats03036]     109783394 Membrane trafficking [BR:ats04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     109783394 Ubiquitin system [BR:ats04121]  Ubiquitin ligases (E3)   Multi subunit type E3    SCF complex     Adaptor protein      109783394    Cul7 complex      109783394 Chromosome and associated proteins [BR:ats03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      109783394   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      109783394 SSDB OrthologParalogGFIT Motif Pfam:  Skp1 Skp1_POZ Motif Other DBs NCBI-GeneID:  109783394 NCBI-ProteinID:  XP_020197618 UniProt:  A0A453J4N1 LinkDB All DBs Position 4:499635950..499636511 Genome browser AA seq 156 aa AA seqDB search MKMVRLRSSDGEEFEVAEETIGAASVMIKGMLEDDVAVVVIPLPNVTGPILSRILDYVNR HFSDPHNVTSHTPGADDPLRRFDDSFVQVDQDTLFDLMLAANYLDMQSLLDLTCKTVADQ IRGRTLEEIRKKFNIRNDYTKDEEQEVRRENSWAFN NT seq 471 nt NT seq  +upstreamnt  +downstreamnt atgaagatggttcgtctccgcagctccgacggcgaggagttcgaggtggcggaggagacc atcggcgcggcgtcggtgatgatcaagggcatgctagaggacgacgtcgccgtcgtcgtg atcccgctccccaacgtgaccggccccatcctctcccgcatcctcgactacgtcaacagg cacttctccgacccccacaacgtcacctcgcacacccccggcgccgacgaccccctcagg cggttcgacgactccttcgtccaggtcgaccaggacaccctcttcgacctcatgctcgct gccaattacctcgacatgcagagcctgctcgacctgacgtgcaagacggtggcggaccag atcaggggcaggaccctcgaggagatccgcaagaagttcaacatccgcaacgactacacc aaggatgaggagcaggaggtccgcagggagaactcgtgggcattcaattag

DBGET integrated database retrieval system