Acinetobacter sp. TTH0-4: AMQ28_04785 Help Entry AMQ28_04785       CDS       T04075                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism att  Acinetobacter sp. TTH0-4 Pathway att01100   Metabolic pathways att01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:att00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     AMQ28_04785    00074 Mycolic acid biosynthesis     AMQ28_04785   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     AMQ28_04785 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Motif Other DBs NCBI-ProteinID:  ALD01739 UniProt:  A0A0M4GXY2 LinkDB All DBs Position complement(1009160..1009396) Genome browser AA seq 78 aa AA seqDB search MSDIELRIKQAVAEQLGLKAEEIKNEASFMDDLGADSLDLVELVMSFENDFDITIPDEDS NEITTVQSAIDYVSKKLG NT seq 237 nt NT seq  +upstreamnt  +downstreamnt gtgagcgatatcgaactacgtatcaaacaagcggttgcagaacaacttggtcttaaagct gaagagattaaaaacgaagcatcttttatggatgacttaggtgctgactctttagacttg gttgaacttgttatgtctttcgaaaatgatttcgacatcactatccctgatgaagattct aacgaaatcacaactgtacaatctgcaattgactatgtttctaagaaactaggttaa

DBGET integrated database retrieval system