KEGG   Agrobacterium fabrum: Atu6015
Entry
Atu6015           CDS       T00070                                 
Symbol
nos
Name
(GenBank) D-nopaline dehydrogenase
  KO
K00296  D-nopaline dehydrogenase [EC:1.5.1.19]
Organism
atu  Agrobacterium fabrum
Pathway
atu00330  Arginine and proline metabolism
atu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:atu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    Atu6015 (nos)
Enzymes [BR:atu01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.19  D-nopaline dehydrogenase
     Atu6015 (nos)
SSDB
Motif
Pfam: Octopine_DH NAD_Gly3P_dh_N
Other DBs
NCBI-ProteinID: AAK90973
UniProt: A9CL08
LinkDB
Position
Ti:complement(23231..24472)
AA seq 413 aa
MAITLSATSLPISAADHHPLPLTVGVLGSGHAGTALAAWFASRHVPTALWAPADHPGSIS
AIKASEGVITTEGMINGPFRVSACDDLAAVIRSSRVLIIVTRADVHDSFVNELANFNGEL
ATKDIVVVCGHGFSIKYERQLRFKRIFETDNSPITSKLSDQKKCNVNIKEMKASFGLSCF
PIHRDDAGVIDLPEDTKNIFAQLFSARIICIPPLQVLFFSNYITHAVPAVMNIGRLRDPA
NSLTKRAEKWLLELDERTPRAEKGFFFYGEGSNTYVCNVQEQIDHERRKVAAACGLRLNS
LLQECNDEYDTDYETLREYCLAPSPHNVHHACPDNMEHRYFSEELCSLEDVAAIAAIAKI
EIPLTHAFINIIHAGKGKINPTGKSSSVIGNFSSSDLIRFGATHVFNKDEMVE
NT seq 1242 nt   +upstreamnt  +downstreamnt
atggcaattaccttatccgcaacttctttacctatttccgccgcagatcaccatccgctt
cccttgaccgtaggtgtcctcggttctggtcacgcggggactgcattagcggcttggttc
gcctcccggcacgttcccacggcgctgtgggcaccagcagatcatccaggatcgatctca
gcaatcaaggccagtgaaggagttatcaccaccgagggaatgattaacggtccatttagg
gtctcagcctgtgatgaccttgccgcagttattcgctccagccgtgtactgattattgta
acccgtgcggacgttcacgacagcttcgtcaacgaactcgccaacttcaacggcgaactc
gcaacaaaggatattgtcgtcgtgtgcggccatggcttctccatcaagtacgagagacag
ctgcgattcaagcgaatattcgagacggataattcgcccataacgtctaagctatcggat
caaaaaaaatgtaacgtcaacatcaaggaaatgaaagcgtctttcggactgtcatgtttc
ccaattcatcgcgatgatgctggcgtgattgatctacccgaagataccaagaacatcttt
gcccagctattttccgctagaatcatctgcatcccgccgttgcaagtgctattcttttcc
aactatatcactcatgcggttccggcagtcatgaacatcggaagactccgcgacccagcc
aattctcttactaaaagagctgagaagtggcttcttgaactagacgagcgaaccccacga
gccgagaagggctttttcttttatggtgaaggatccaacacttacgtttgcaacgtccaa
gagcaaatagaccacgaacgccggaaggttgccgcagcgtgtggactgcgtctcaattct
ctcttgcaggaatgcaatgatgaatatgatactgactatgaaactttgagggaatactgc
ctagcaccgtcacctcataacgtgcatcatgcatgccctgacaacatggaacatcgctat
ttttctgaagaattatgctcgttggaggatgtcgcggcaattgcagctattgccaaaatc
gaaatacccctcacgcatgcattcatcaatattattcatgcggggaaaggcaagattaat
ccaactggcaaatcatccagcgtgattggtaacttcagttccagcgacttgattcgtttt
ggtgctacccacgttttcaataaggacgagatggtggagtaa

DBGET integrated database retrieval system