KEGG   Agrobacterium fabrum: Atu6019
Entry
Atu6019           CDS       T00070                                 
Symbol
noxA
Name
(GenBank) D-nopaline dehydrogenase
  KO
K24952  nopaline oxidase subunit A
Organism
atu  Agrobacterium fabrum
Pathway
atu00330  Arginine and proline metabolism
atu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:atu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    Atu6019 (noxA)
SSDB
Motif
Pfam: Pyr_redox_2 Fer2_BFD NAD_binding_8 SO_alpha_A3 DAO FAD_oxidored Thi4 FAD_binding_2 HI0933_like Lycopene_cycl NAD_binding_9 Pyr_redox_3 AlaDh_PNT_C FAD_binding_3 GIDA
Other DBs
NCBI-ProteinID: AAK90977
UniProt: A9CL06
LinkDB
Position
Ti:complement(28273..29691)
AA seq 472 aa
MNHHSSADLLIVGAGPAGMAAARRAVRGGLSVIVLDSQSQPGGQIWRNAGRNATSPIINI
LGAEYRRGVRQVEAFLACGADYIPDAQVSRLSQGWTVEYVWGGEIRSVRGRHLLLATGAQ
ERPVPFTGWTLPGVMTVGAAQILLKTAGQLPRGPVAVVGSGPLPLLYMQQMRLAGAKPVA
HLDTTPRGLISRSLRGFRGALQEPGQILKGIAWLPQFSGVRHVRNVVKISAKGSGRLETV
RFETSSGRSDRLEVKSLLVHEGLVPSHQLAVSAGAQLMWDVGQSAFRLERDEWMNAGPDG
LYIAGDGARIGGAVNAEIEGEIAAIGVLLRDGALTAAQADTETKPLRAQHGRQKSFRRFL
DGAYPPNIARTPPDDATIVCRCEELSAGVLREAAVRGACRGPNQLKSFTRAGMGPCQGRQ
CGYPVHELVKSVAGLTAGEVGLFNPRPPFVPLTVSMLAAQQAEEVVSASTHE
NT seq 1419 nt   +upstreamnt  +downstreamnt
atgaaccatcattcgagcgccgacctgttgatcgtcggagccggccccgctggcatggcc
gcagcgaggcgcgctgtacgcggcggtctgtccgtcatcgtgctggattcgcaatcacag
cctggaggtcagatctggcgcaatgccggccgcaacgctacaagcccaatcataaacatt
ctgggggcggaatatcgacgcggcgtccggcaagtcgaagcatttctggcctgtggcgcc
gactacatcccggatgctcaggtaagcaggctcagccagggttggacggtggaatacgtc
tggggcggagaaattcgctccgtcaggggacggcatctcttgctcgctacgggcgcacag
gaacgcccggttccgttcaccggctggacgctacccggcgtcatgacggttggcgccgca
cagatcctgttgaaaacggcaggtcagttgccgagaggccccgttgccgtcgtcggcagc
gggcctctcccgctgctatatatgcagcagatgcggctcgcgggggcaaagccggtcgct
catctcgatacgacccctcggggtctcatcagccgttcgctgcgcggttttcgcggagca
ctgcaggagcctggccaaatcctgaaagggattgcctggttaccgcagttcagtggcgtt
cggcacgtacgcaacgtggtcaaaatcagcgccaagggaagcggacgactggaaactgta
cggttcgaaacttcaagcggaaggtccgacagattggaggtcaaatcccttcttgttcac
gaggggctggtgccaagccatcagttggcggtgtcggccggcgcgcaactgatgtgggat
gtcggccagtcagcgttccggcttgagcgcgacgagtggatgaacgcaggtccggacgga
ctatacatagccggggacggtgcgcggatcggaggcgccgtcaatgccgagatcgaggga
gagatcgccgcgatcggcgtccttcttcgtgacggcgccctgacggccgctcaggcggat
accgagacaaaaccgctgagagcgcagcatggccggcaaaagtcgttccggcgatttctg
gatggggcctacccgccgaatattgcgcggaccccgccggacgacgcaacgatcgtctgc
cggtgcgaggagttgagcgcgggcgtgttgagggaagctgctgtccgtggcgcttgccga
ggccccaaccagctgaagagttttacgcgcgcgggcatgggtccctgtcagggaaggcag
tgcggctacccggtgcacgagctggtgaagtcagtcgccgggctgaccgccggcgaggtc
ggcctgttcaatccgcggcctcccttcgttccattaacggtgtcgatgctggcagctcag
caggccgaggaagtcgtttcagcgtcgacacatgagtga

DBGET integrated database retrieval system