KEGG   Agrobacterium fabrum: Atu6021
Entry
Atu6021           CDS       T00070                                 
Symbol
noxB
Name
(GenBank) D-nopaline dehydrogenase
  KO
K24953  nopaline oxidase subunit B
Organism
atu  Agrobacterium fabrum
Pathway
atu00330  Arginine and proline metabolism
atu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:atu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00330 Arginine and proline metabolism
    Atu6021 (noxB)
SSDB
Motif
Pfam: DAO Pyr_redox_3 Pyr_redox_2 HI0933_like NAD_binding_8 Pyr_redox 3HCDH_N FAD_binding_3 ApbA FAD_binding_2 F420_oxidored UDPG_MGDP_dh_N TrkA_N
Other DBs
NCBI-ProteinID: AAK90979
UniProt: Q7D2Q6
LinkDB
Position
Ti:complement(29978..31096)
AA seq 372 aa
MDHEFETAIVGGGVVGAAIGYGLAKLGRRVIIIDGADDALRASRTNFGLIWVQGKGDEYP
AYHRITRQSAELWPGFASELKELTGVDVEYRRNGGLLFCASEAQAEEEKAIGEKMAAIHP
DYRFEMLERSRIERMLPDIRLGPKVCSASFSHMDGDVNPLLVLRAMLDGFVRLGGTLMTG
EHVDSIAPTLGGFRLATDGLTIEAERVIIAAGNDSMAFAKSLDLPLLLVPEKGQLLITER
VAPVFPYAASGIRQTMTGTFQLGVTNERVGRSTDVTAAGARHIANRAINVMPDVGALRVI
RQWAGLRVLTPDGVPVYDRSRRYPGIHVVACHSGVTLAALHAGPFAEWLAAGGREPSYDA
FRGSRFKMGIAA
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggatcacgagttcgagacagccattgttggcggcggtgtagtgggcgccgcaattgga
tacgggttagccaagttggggcgccgggtgatcatcatcgatggcgcggacgatgcgctg
cgtgcgtcccgaacgaatttcggcctgatctgggttcagggcaagggcgacgaatatcct
gcatatcatcgcatcacgcggcaaagcgctgagctgtggcccggttttgcatccgagttg
aaagaactgacgggtgtcgacgtggagtaccgccgcaacggtggtttgctcttctgtgcg
tcggaagctcaggcagaagaagaaaaagcgatcggcgagaagatggctgccattcatcct
gactatcgcttcgagatgctggagcgctcgcgcatcgagcgcatgcttcccgacatccgt
ctcgggccgaaggtgtgttcagcgtcgttcagtcatatggacggtgacgtcaatcctctg
ctggtccttcgcgctatgctggacggatttgtgcgcctcggtggaaccttgatgacgggc
gaacacgtcgacagcatcgcgcccacgcttggcggcttccgactggcgacggatggcctc
acgatagaggcggagcgggtgattattgcagcgggaaatgactccatggcttttgccaag
agcctggaccttccgcttctgctcgtcccggaaaaggggcagcttctcatcacggaacgg
gtcgccccggttttcccttacgccgccagcggtatccgtcagaccatgacgggcacgttt
cagctcggcgttacgaatgaacgtgtgggccggtctaccgacgtgacagctgccggcgca
cgtcatatcgccaatcgcgcgatcaatgtgatgcctgacgtcggcgcgttgcgtgtcata
cggcagtgggcgggactacgcgtgctgaccccggacggggtgcctgtctacgatcggtcg
cggcgatacccaggtatccacgtcgtcgcatgccattccggcgtcacccttgccgctctg
catgcaggtccttttgccgaatggttggcagccggtggaagggagccatcctacgacgct
ttccgcggcagcagattcaagatggggatcgcggcgtga

DBGET integrated database retrieval system