Pseudazoarcus pumilus: C0099_05110 Help Entry C0099_05110       CDS       T05265                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism atw  Pseudazoarcus pumilus Pathway atw01100   Metabolic pathways atw01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:atw00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     C0099_05110    00074 Mycolic acid biosynthesis     C0099_05110   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     C0099_05110 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1493 DUF5783 DUF1896 DUF7127 Motif Other DBs NCBI-ProteinID:  AUN94371 UniProt:  A0A2I6S543 LinkDB All DBs Position 1065766..1066005 Genome browser AA seq 79 aa AA seqDB search MENIEQRVKKIVAEQLGVNESEIKNESSFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITNVQQAIDYVNAHLKK NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atggagaacatcgaacagcgcgtcaagaagatcgttgccgagcagcttggcgtcaacgag tcggagatcaagaatgagtcctcgtttgtggacgatctcggcgcggattcgctcgacacg gtcgagctggtgatggccctcgaagaggaattcgagtgcgagattccggacgaggaagcc gagaagatcaccaacgtccagcaggcgattgactacgtcaacgcgcatctgaagaagtaa

DBGET integrated database retrieval system