Pseudazoarcus pumilus: C0099_13720 Help Entry C0099_13720       CDS       T05265                                  Name (GenBank) DNA-binding protein HU   KO K03530   DNA-binding protein HU-beta Organism atw  Pseudazoarcus pumilus Brite KEGG Orthology (KO) [BR:atw00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:atw03032]     C0099_13720    03036 Chromosome and associated proteins [BR:atw03036]     C0099_13720    03400 DNA repair and recombination proteins [BR:atw03400]     C0099_13720 DNA replication proteins [BR:atw03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     C0099_13720 Chromosome and associated proteins [BR:atw03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     C0099_13720 DNA repair and recombination proteins [BR:atw03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       C0099_13720 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 Motif Other DBs NCBI-ProteinID:  AUN95896 UniProt:  A0A2I6S9F9 LinkDB All DBs Position complement(2816055..2816330) Genome browser AA seq 91 aa AA seqDB search MNKTELIERVAARTALSKARVAEVLDAQRDVLVEALHEEGEAVLPGLGKIKAAPRAARTA RNPRTGDPVQIPERIAARFSAGKALVDALNL NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaacaaaaccgaactgatcgaacgtgtcgccgcgcgcaccgcgctgtcgaaggcccgg gtcgcggaagtgctcgacgcccagcgcgatgtgctcgtcgaagccctgcacgaggagggc gaagccgtgctgccgggcctcggcaagatcaaggccgcgccgcgcgccgcgcgcaccgcg cgcaacccgcgcaccggcgatccggtgcagatccccgagcgcatcgccgcccgcttcagc gccggcaaggcgctggtcgacgcactcaacctctga

DBGET integrated database retrieval system