Acidithiobacillus thiooxidans: GCD22_01063 Help Entry GCD22_01063       CDS       T06281                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism atx  Acidithiobacillus thiooxidans Pathway atx01100   Metabolic pathways atx01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:atx00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     GCD22_01063 (acpP)    00074 Mycolic acid biosynthesis     GCD22_01063 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     GCD22_01063 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 HLH Motif Other DBs NCBI-ProteinID:  QFX95481 UniProt:  A0A5P9XNB1 LinkDB All DBs Position 988345..988593 Genome browser AA seq 82 aa AA seqDB search MENVAERVKKVVVEQLGVNEDEVTNEASFVDDLGADSLDTVELVMALEEEFDCEIPDEEA EKIATVQQAIDYVSSHMPANDA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggaaaatgtggcagaacgagtaaagaaagtagtagtcgagcagttgggtgtcaatgaa gatgaagtgaccaatgaggcttcctttgtggatgacctgggcgccgattctttggacacc gtggaactggtcatggccctcgaagaagaattcgactgtgaaattcctgatgaagaagct gaaaaaattgctaccgtgcagcaggctattgattatgtatcctctcacatgcccgccaat gatgcctga

DBGET integrated database retrieval system